BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000070-TA|BGIBMGA000070-PA|undefined (267 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 24 1.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 5.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 7.3 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 9.7 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.7 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 170 EPNQHIKAELAANITTIEVII 190 +PNQH+K+ LA+ I + I+ Sbjct: 338 DPNQHVKSALASVIMGLSPIL 358 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 167 VHLEPNQHIKAELAANIT 184 ++++P H K E+ NIT Sbjct: 309 INIDPENHNKTEIFLNIT 326 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 131 ITYDIKLDDFPRILFIANYNQNAKKYEVVKI 161 +T D L +P I + N QNAK + ++ Sbjct: 329 LTKDAGLLSYPEICTLLNDPQNAKTQKAFQV 359 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 65 WEEVERHFRPQRAIKNIIKN 84 WE++++ F PQ K +N Sbjct: 96 WEQLQKKFDPQGIYKKRYQN 115 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 141 PRILFIANYNQNAKKYEVVKID 162 P LF+A + K Y + K+D Sbjct: 52 PEQLFLAERERGLKYYPIYKLD 73 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.132 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,247 Number of Sequences: 317 Number of extensions: 2665 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 267 length of database: 114,650 effective HSP length: 56 effective length of query: 211 effective length of database: 96,898 effective search space: 20445478 effective search space used: 20445478 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -