BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000070-TA|BGIBMGA000070-PA|undefined (267 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D79995-1|BAA11490.2| 1203|Homo sapiens KIAA0173 protein. 30 7.3 BC021707-1|AAH21707.1| 1199|Homo sapiens tubulin tyrosine ligase... 30 7.3 >D79995-1|BAA11490.2| 1203|Homo sapiens KIAA0173 protein. Length = 1203 Score = 30.3 bits (65), Expect = 7.3 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Query: 186 IEVIIDYEAHLTGLTAVNYVRKYDNHHFWGLDINTVMAASRLKPTV-KVMEEITIEYYSD 244 ++ II E ++T L + R Y H +G DI M LKP V +V ++ S Sbjct: 866 VKTIISSEPYVTSLLKMYVRRPYSCHELFGFDI---MLDENLKPWVLEVNISPSLHSSSP 922 Query: 245 AKIIITDQNTSDVLN 259 I I Q D+LN Sbjct: 923 LDISIKGQMIRDLLN 937 >BC021707-1|AAH21707.1| 1199|Homo sapiens tubulin tyrosine ligase-like family, member 4 protein. Length = 1199 Score = 30.3 bits (65), Expect = 7.3 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Query: 186 IEVIIDYEAHLTGLTAVNYVRKYDNHHFWGLDINTVMAASRLKPTV-KVMEEITIEYYSD 244 ++ II E ++T L + R Y H +G DI M LKP V +V ++ S Sbjct: 862 VKTIISSEPYVTSLLKMYVRRPYSCHELFGFDI---MLDENLKPWVLEVNISPSLHSSSP 918 Query: 245 AKIIITDQNTSDVLN 259 I I Q D+LN Sbjct: 919 LDISIKGQMIRDLLN 933 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.316 0.132 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,909,831 Number of Sequences: 224733 Number of extensions: 1292815 Number of successful extensions: 2652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2652 Number of HSP's gapped (non-prelim): 2 length of query: 267 length of database: 73,234,838 effective HSP length: 89 effective length of query: 178 effective length of database: 53,233,601 effective search space: 9475580978 effective search space used: 9475580978 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -