BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000069-TA|BGIBMGA000069-PA|IPR004343|Plus-3 (763 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 1.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 1.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 569 QLRGDDELVMDLNSKIEELEERANQLDKTRTSSIQSISYINNRNRKLNVETAEKAIME 626 QLR E + DLN KIE LE+ Q R+ ++ +++ ++ E ME Sbjct: 1101 QLRKIQESLRDLNRKIESLEKM--QYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYME 1156 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 569 QLRGDDELVMDLNSKIEELEERANQLDKTRTSSIQSISYINNRNRKLNVETAEKAIME 626 QLR E + DLN KIE LE+ Q R+ ++ +++ ++ E ME Sbjct: 1101 QLRKIQESLRDLNRKIESLEKM--QYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYME 1156 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.127 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,970 Number of Sequences: 317 Number of extensions: 4053 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 2 length of query: 763 length of database: 114,650 effective HSP length: 62 effective length of query: 701 effective length of database: 94,996 effective search space: 66592196 effective search space used: 66592196 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -