BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000067-TA|BGIBMGA000067-PA|IPR007110|Immunoglobulin- like, IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2, IPR013098|Immunoglobulin I-set, IPR013151|Immunoglobulin (397 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A7.11 |mip1||WD repeat protein Mip1|Schizosaccharomyces po... 33 0.093 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 28 2.0 SPBC29A10.14 |rec8||meiotic cohesin complex subunit Rec8|Schizos... 27 4.6 SPAC1952.15c |rec24|mug6|meiotic recombination protein Rec24|Sch... 27 4.6 SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting pro... 27 4.6 >SPAC57A7.11 |mip1||WD repeat protein Mip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1313 Score = 32.7 bits (71), Expect = 0.093 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Query: 123 RGVDMGNYTCLLTNSVGNGTSEDNIVVNVLCEWLSFYVLSFWVVTNDLQGSGSKSQAKNV 182 RG G CL + + S N ++L +W + W ++ + SG++ A Sbjct: 608 RGFPQGQLACLNPQVLSHCLSHLNSPDSLLRQWACLCISQLWENYSEAKWSGTRDNAH-- 665 Query: 183 MRLSNYCIDDKPQVRLTM 200 ++L+ +D P+VR ++ Sbjct: 666 VKLAEIIVDSVPEVRASV 683 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 28.3 bits (60), Expect = 2.0 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 10/95 (10%) Query: 286 GWGDVSEKTELVVNSPPSF----QYAMNHYSGALYKSQVSFMWKLKNVNDSLTDEKIWQA 341 G + S K +V + P +YA+NH + K+ + WK K DS T Sbjct: 440 GLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIACIGKASIMLDWKHKRTPDSDTQMIFATT 499 Query: 342 GTQS--YLRLSP----GVDVYRTYLCFANNSVGVS 370 Q YL+ SP VD + F+N +V + Sbjct: 500 FPQDMCYLKFSPFDASTVDWKNSKEAFSNEAVSAA 534 >SPBC29A10.14 |rec8||meiotic cohesin complex subunit Rec8|Schizosaccharomyces pombe|chr 2|||Manual Length = 561 Score = 27.1 bits (57), Expect = 4.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 288 GDVSEKTELVVNSPPSFQYAMNH 310 GD+ E T+ +NS PS Q A H Sbjct: 210 GDIQELTKGTINSDPSLQAASQH 232 >SPAC1952.15c |rec24|mug6|meiotic recombination protein Rec24|Schizosaccharomyces pombe|chr 1|||Manual Length = 350 Score = 27.1 bits (57), Expect = 4.6 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 10/89 (11%) Query: 123 RGVDMGNYTC---LLTNSVGNGTSEDNIVVNVLCEWLSFYVLSFWVVTNDLQGSGSKSQA 179 R V++G+Y ++T S+ + + V ++L FYV ++ N L + + Sbjct: 189 RLVELGDYVLDLIIITQSIMQNNANNGTGVISRAKFLEFYVFLEQLIFNKLSFASVEQLE 248 Query: 180 KN----VMRLS---NYCIDDKPQVRLTMS 201 K V R+ YC +D P +RL S Sbjct: 249 KLLDQIVKRMKICFTYCKNDNPSIRLLYS 277 >SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting protein 3 homolog Bud6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1385 Score = 27.1 bits (57), Expect = 4.6 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 295 ELVVNSPPS-FQYAMNHYSGALYKSQVSFMWKLKNVNDSLTD 335 EL + P + Y + S YKS VSFM+K ++ N D Sbjct: 833 ELNIEDPDTKISYLLEDLSDLKYKSLVSFMFKEQDANKKRED 874 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.133 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,019,021 Number of Sequences: 5004 Number of extensions: 89857 Number of successful extensions: 184 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 181 Number of HSP's gapped (non-prelim): 6 length of query: 397 length of database: 2,362,478 effective HSP length: 74 effective length of query: 323 effective length of database: 1,992,182 effective search space: 643474786 effective search space used: 643474786 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -