BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000066-TA|BGIBMGA000066-PA|IPR001515|Ribosomal protein L32e (134 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 3.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 20 6.7 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 20 8.9 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 20 8.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 20 8.9 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 3.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 26 RYDKLKRNWRKPRGIDNR 43 +++ L +W PRG D+R Sbjct: 631 QFNGLDVDWEYPRGADDR 648 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 20.2 bits (40), Expect = 6.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 104 SKKRKLIVERAQQLSIRVTNAAA 126 SKKR+ ++ AQQ++ + A Sbjct: 303 SKKRRELLRLAQQVNANIAQITA 325 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 19.8 bits (39), Expect = 8.9 Identities = 10/37 (27%), Positives = 18/37 (48%) Query: 52 YLMPNIGYGSNKKTRHMLPNGFRKVLVHNVKELEILM 88 YL + YG ++ T H + + + NV + E L+ Sbjct: 9 YLFLFVHYGWSEDTTHKYTTKYDNIDLENVVKNERLL 45 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 49 KGQYLMPNIGYGSN 62 KGQ+ PN G+ +N Sbjct: 317 KGQFRDPNTGFMTN 330 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 49 KGQYLMPNIGYGSN 62 KGQ+ PN G+ +N Sbjct: 317 KGQFRDPNTGFMTN 330 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.136 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,634 Number of Sequences: 317 Number of extensions: 1133 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 134 length of database: 114,650 effective HSP length: 51 effective length of query: 83 effective length of database: 98,483 effective search space: 8174089 effective search space used: 8174089 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.1 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -