Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000065-TA|BGIBMGA000065-PA|IPR001216|Cysteine
synthase/cystathionine beta-synthase P-phosphate-binding site,
IPR001926|Pyridoxal-5'-phosphate-dependent enzyme, beta subunit
         (440 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450 CY...    24   9.4  

>AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450
           CYP6S2 protein.
          Length = 504

 Score = 23.8 bits (49), Expect = 9.4
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 202 KVKEKCPKCIIVTVDPQGSLIFGEGPADLYFVE 234
           K + K  KC+  T+   G+ +  E   D+Y++E
Sbjct: 324 KAQRKARKCVRSTLAKHGNEMTYEAIKDMYYLE 356


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.137    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 447,773
Number of Sequences: 2123
Number of extensions: 18265
Number of successful extensions: 23
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 440
length of database: 516,269
effective HSP length: 66
effective length of query: 374
effective length of database: 376,151
effective search space: 140680474
effective search space used: 140680474
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 49 (23.8 bits)