BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000065-TA|BGIBMGA000065-PA|IPR001216|Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site, IPR001926|Pyridoxal-5'-phosphate-dependent enzyme, beta subunit (440 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 24 9.4 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.8 bits (49), Expect = 9.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 202 KVKEKCPKCIIVTVDPQGSLIFGEGPADLYFVE 234 K + K KC+ T+ G+ + E D+Y++E Sbjct: 324 KAQRKARKCVRSTLAKHGNEMTYEAIKDMYYLE 356 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.137 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 447,773 Number of Sequences: 2123 Number of extensions: 18265 Number of successful extensions: 23 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 1 length of query: 440 length of database: 516,269 effective HSP length: 66 effective length of query: 374 effective length of database: 376,151 effective search space: 140680474 effective search space used: 140680474 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -