BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000064-TA|BGIBMGA000064-PA|IPR000866|Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen, IPR012336|Thioredoxin-like fold (227 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putat... 228 2e-60 At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1)... 228 3e-60 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 77 1e-14 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 73 2e-13 At3g08950.1 68416.m01045 electron transport SCO1/SenC family pro... 35 0.052 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 32 0.37 At1g50830.1 68414.m05716 hypothetical protein 29 2.6 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 29 3.4 At5g02180.1 68418.m00139 amino acid transporter family protein b... 28 6.0 At1g58227.1 68414.m06616 hypothetical protein 28 6.0 At5g66510.1 68418.m08386 bacterial transferase hexapeptide repea... 27 7.9 At1g56630.1 68414.m06513 lipase class 3 family protein contains ... 27 7.9 >At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putative very strong similarity to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 273 Score = 228 bits (558), Expect = 2e-60 Identities = 111/208 (53%), Positives = 149/208 (71%), Gaps = 6/208 (2%) Query: 20 AKRINFSTTSTTR-APKVQKPAPDFSATAVVNGEFNQLKLSDFTGK-YVVLFFYPLDFTF 77 A R NF+ + P V APDF A AV + EF ++KLS++ GK YV+LFFYPLDFTF Sbjct: 65 ASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTF 124 Query: 78 VCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRNDGGLGKMEIPLLADYKK 137 VCPTE+ AFSD+ ++F ++ +V+GVS DS FSHLAW+ T R GGLG + PL++D K Sbjct: 125 VCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITK 184 Query: 138 QISKDYDVLL-DDGFALRGLFIIDRNGTLRHMSVNDLPVGRSVDETLRLVKAFQFADKH- 195 ISK + VL+ D G ALRGLFIID+ G ++H ++N+L +GRSVDET+R ++A Q+ ++ Sbjct: 185 SISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENP 244 Query: 196 GEVCPAGWNPDTNADTIKPNPKDSKEYF 223 EVCPAGW P ++KP+PK SKEYF Sbjct: 245 DEVCPAGWKP--GEKSMKPDPKLSKEYF 270 >At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1) identical to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 266 Score = 228 bits (557), Expect = 3e-60 Identities = 108/193 (55%), Positives = 142/193 (73%), Gaps = 5/193 (2%) Query: 34 PKVQKPAPDFSATAVVNGEFNQLKLSDFTGK-YVVLFFYPLDFTFVCPTELIAFSDKAKD 92 P V APDF A AV + EF ++KLSD+ GK YV+LFFYPLDFTFVCPTE+ AFSD+ + Sbjct: 73 PLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSE 132 Query: 93 FAGIDCQVIGVSTDSEFSHLAWINTPRNDGGLGKMEIPLLADYKKQISKDYDVLL-DDGF 151 F ++ +V+GVS DS FSHLAW+ T R GGLG + PL++D K ISK + VL+ D G Sbjct: 133 FEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGI 192 Query: 152 ALRGLFIIDRNGTLRHMSVNDLPVGRSVDETLRLVKAFQFADKH-GEVCPAGWNPDTNAD 210 ALRGLFIID+ G ++H ++N+L +GRSVDET+R ++A Q+ ++ EVCPAGW P Sbjct: 193 ALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKP--GEK 250 Query: 211 TIKPNPKDSKEYF 223 ++KP+PK SKEYF Sbjct: 251 SMKPDPKLSKEYF 263 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 76.6 bits (180), Expect = 1e-14 Identities = 49/158 (31%), Positives = 78/158 (49%), Gaps = 6/158 (3%) Query: 54 NQLKLSD-FTGKYVVLFFYPLDFTFVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHL 112 ++ KL D F + VLF +P DFT VC TEL A + A +F +++G+S D SH Sbjct: 20 DKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHK 79 Query: 113 AWINTPRNDGGLGKMEIPLLADYKKQISKDYDVL--LDDGFALRGLFIIDRNGTLRHMSV 170 WI K+ P++AD K+I +++ +++G R L I+ + ++ + Sbjct: 80 DWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENG-PSRALHIVGPDSKIKLSFL 138 Query: 171 NDLPVGRSVDETLRLVKAFQFADKHGE--VCPAGWNPD 206 GR++DE LR + + A KH P W PD Sbjct: 139 YPSTTGRNMDEVLRALDSLLMASKHNNKIATPVNWKPD 176 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 72.5 bits (170), Expect = 2e-13 Identities = 51/151 (33%), Positives = 78/151 (51%), Gaps = 12/151 (7%) Query: 40 APDFSATAVVNGEFNQLKLSDFTGKYVVLFFYPLDFTFVCPTELIAFSDKAKDFAGIDCQ 99 APDF+ NG+ + L + GK VVL+FYP D T C + AF D + F + Sbjct: 75 APDFTLKDQ-NGK--PVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAE 131 Query: 100 VIGVSTDSEFSHLAWINTPRNDGGLGKMEIPLLADYKKQISKDYDVLLDDGFALRG--LF 157 VIG+S D SH A+ + K+ LL+D ++ KD+ V D AL G + Sbjct: 132 VIGISGDDSASHKAFASK-------YKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTY 184 Query: 158 IIDRNGTLRHMSVNDLPVGRSVDETLRLVKA 188 ++D+NG ++ + N + +DETL+ +KA Sbjct: 185 VLDKNGVVQLIYNNQFQPEKHIDETLKFLKA 215 >At3g08950.1 68416.m01045 electron transport SCO1/SenC family protein similar to SP|P23833 SCO1 protein, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF02630: SCO1/SenC Length = 334 Score = 34.7 bits (76), Expect = 0.052 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%) Query: 23 INFSTTSTTRAPKVQKPAPDFSATAVVNGEFNQLKLSDFTGKYVVLFFYPLDFTFVCPTE 82 IN ++ + P K A +++ + ++ + GK+ +L+F +CP E Sbjct: 155 INKNSIAVKEGPSAGKAAIG-GPFSLIRDDGKRVTEKNLMGKWTILYFGFTHCPDICPDE 213 Query: 83 LI---AFSDKAKDFAGIDCQVIGVSTDSE 108 LI A DK K+ +G+D + +S D E Sbjct: 214 LIKLAAAIDKIKENSGVDVVPVFISVDPE 242 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 31.9 bits (69), Expect = 0.37 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 7/71 (9%) Query: 49 VNGEFNQLKLSD-FTGKYVVLFFYPLDFTFVCPTELI----AFSDKAKDFAGIDCQVIGV 103 V+ +F+ LSD F GK VV+F P +T VC + + + DK K GID VI V Sbjct: 58 VSSKFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFK-AKGID-SVICV 115 Query: 104 STDSEFSHLAW 114 S + F+ W Sbjct: 116 SVNDPFAINGW 126 >At1g50830.1 68414.m05716 hypothetical protein Length = 768 Score = 29.1 bits (62), Expect = 2.6 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 9/110 (8%) Query: 19 VAKRINFSTTSTTRAPKV-----QKPAPDFSATAVVNGEFNQLKLSDFTGKYVVLFFYPL 73 + + I ST S T+ P + +K P+ + GE + L D V+L F L Sbjct: 102 IFEAIKVSTYSITKNPSLILSVSEKWCPETKSFVFPWGEAT-ITLEDVM---VLLGFSVL 157 Query: 74 DFTFVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRNDGG 123 P E D K + Q + STD S +W++T GG Sbjct: 158 GSPVFAPLETSETRDSVKKLENVRIQHMNSSTDRRVSQKSWVSTFLGRGG 207 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 64 KYVVLFFYPLDFTFVCPTELIAFSDKAKDFAGIDCQ 99 KY V FF + FV P ++ AF+ +AK CQ Sbjct: 52 KYFVQFFGTEEIAFVAPPDIQAFTSEAKSKLLARCQ 87 >At5g02180.1 68418.m00139 amino acid transporter family protein belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 550 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Query: 1 MSFIVKQLSRSVLSPAFKVAKRINF--STTSTTRAPKVQKPAPDFSATAVVNGEFNQLKL 58 +SF+ + SR + S +F+ ++ +F S +S++ P + +P PD T + +QLKL Sbjct: 88 VSFMPQSSSRRLAS-SFQKKQQSSFCDSLSSSSSKPLLSQPVPDKEETILPVNPQSQLKL 146 Query: 59 S 59 S Sbjct: 147 S 147 >At1g58227.1 68414.m06616 hypothetical protein Length = 1323 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/92 (20%), Positives = 38/92 (41%), Gaps = 8/92 (8%) Query: 68 LFFYPLDFTFVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRNDGGLGKM 127 +F + +F C L + +D + V EF AW+ M Sbjct: 1100 IFVFIFEFLSGCKDGLARMKIISDILDLLDSNPMNVEALMEFGWSAWLTA--------SM 1151 Query: 128 EIPLLADYKKQISKDYDVLLDDGFALRGLFII 159 ++ ++ DY+ ++ D+ L++ +RGLF + Sbjct: 1152 KLDVIKDYRSELLNHDDLALNEQHFVRGLFCV 1183 >At5g66510.1 68418.m08386 bacterial transferase hexapeptide repeat-containing protein contains Pfam profile PF00132: Bacterial transferase hexapeptide (four repeats) Length = 258 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/46 (32%), Positives = 23/46 (50%) Query: 104 STDSEFSHLAWINTPRNDGGLGKMEIPLLADYKKQISKDYDVLLDD 149 S+ E+S+LA + N L + E L + K +YD +LDD Sbjct: 202 SSAVEYSNLAQAHATENAKNLDEAEFKKLLNKKNARDTEYDSVLDD 247 >At1g56630.1 68414.m06513 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 364 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 114 WINTPRNDGGLGKMEIPLLADYKKQISKDYDVLLD 148 W+N P ++GG K+ + L+ D+ + S + V+ D Sbjct: 82 WLNLPSSNGGFFKIFLNLVKDFDQTRSTEVIVIRD 116 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.137 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,610,618 Number of Sequences: 28952 Number of extensions: 243608 Number of successful extensions: 476 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 458 Number of HSP's gapped (non-prelim): 12 length of query: 227 length of database: 12,070,560 effective HSP length: 79 effective length of query: 148 effective length of database: 9,783,352 effective search space: 1447936096 effective search space used: 1447936096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -