BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000062-TA|BGIBMGA000062-PA|IPR002529|Fumarylacetoacetate (FAA) hydrolase (288 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 0.49 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 25 0.65 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 3.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.5 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.4 bits (53), Expect = 0.49 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Query: 11 SPKNIRVGYLEGDDIVDINKADSSLPTTLLQILRNGDLEKVKKLKSTKPATIPLS 65 S K R Y DD+++ K + TTL +L KVK + T P LS Sbjct: 235 SKKKTRYYYRSVDDVIEKGKRPGAFRTTL-----GSELSKVKVIDMTGPQQRVLS 284 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 92 EQNLTPPPVPMVFSKFSSTI 111 E N PPP P F+ T+ Sbjct: 727 ENNAPPPPPPPRVESFAETV 746 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 25.0 bits (52), Expect = 0.65 Identities = 12/25 (48%), Positives = 15/25 (60%) Query: 43 LRNGDLEKVKKLKSTKPATIPLSSV 67 + NG L+KV LK T PA L S+ Sbjct: 75 ITNGGLQKVAALKKTNPALKALFSL 99 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/59 (23%), Positives = 29/59 (49%) Query: 16 RVGYLEGDDIVDINKADSSLPTTLLQILRNGDLEKVKKLKSTKPATIPLSSVTLTAPIH 74 +V L +++ ++ A +SLPT L++ N + L + +P+ + +LT H Sbjct: 459 QVPALSTPNLLSLSLAFNSLPTVALEVAGNISSLRYLNLDYNDLSAVPIVTHSLTELRH 517 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Query: 67 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP-----PVPMVF 104 + L+ P+ I G+ Y+D C PP P P++F Sbjct: 166 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFVPPPLMF 208 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Query: 67 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP-----PVPMVF 104 + L+ P+ I G+ Y+D C PP P P++F Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFVPPPLMF 441 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Query: 67 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP-----PVPMVF 104 + L+ P+ I G+ Y+D C PP P P++F Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPPYLFFVPPPLMF 441 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.136 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,407 Number of Sequences: 317 Number of extensions: 2933 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 7 length of query: 288 length of database: 114,650 effective HSP length: 56 effective length of query: 232 effective length of database: 96,898 effective search space: 22480336 effective search space used: 22480336 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -