GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000058-TA|BGIBMGA000058-PA|undefined
         (305 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0417 - 3048519-3048710,3048903-3050600,3050622-3050909,305...    33   0.38 

>02_01_0417 - 3048519-3048710,3048903-3050600,3050622-3050909,
            3052308-3052377,3052417-3052668,3053235-3055297
          Length = 1520

 Score = 32.7 bits (71), Expect = 0.38
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 36   THVTSNKTIAPSKAYWNNLDPGSIPDEIQALTQAEQRLLC 75
            TH+   K +A     WN L  G IPD I  L Q E+  LC
Sbjct: 1005 THLIKLKNLATLDLRWNQLT-GKIPDSINQLKQLEELHLC 1043


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.319    0.135    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,659,933
Number of Sequences: 37544
Number of extensions: 351311
Number of successful extensions: 694
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 694
Number of HSP's gapped (non-prelim): 1
length of query: 305
length of database: 14,793,348
effective HSP length: 82
effective length of query: 223
effective length of database: 11,714,740
effective search space: 2612387020
effective search space used: 2612387020
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 60 (28.3 bits)