Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000055-TA|BGIBMGA000055-PA|undefined
         (209 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   8.9  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 22.6 bits (46), Expect = 8.9
 Identities = 15/67 (22%), Positives = 26/67 (38%)

Query: 22   VKRTNAENFNALINLYKINPLKKSKIFRTYADQILLSNKQDTTQSSVLNIDSNESTRMKQ 81
            V    A N  +L+ +  +N   K  +FR     +L      T Q   L+ D   ++    
Sbjct: 1166 VTMVRASNTISLVTVRHVNETSKFVVFRPVDSFLLKMTSLFTKQRVRLDQDELRTSSYNY 1225

Query: 82   AKTDLHM 88
               D+H+
Sbjct: 1226 HPRDVHL 1232


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.314    0.131    0.365 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,826
Number of Sequences: 2123
Number of extensions: 7787
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 209
length of database: 516,269
effective HSP length: 61
effective length of query: 148
effective length of database: 386,766
effective search space: 57241368
effective search space used: 57241368
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 46 (22.6 bits)