GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000054-TA|BGIBMGA000054-PA|IPR012464|Protein of unknown
function DUF1676
         (588 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B pro...    27   0.48 

>EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B
           protein.
          Length = 279

 Score = 26.6 bits (56), Expect = 0.48
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 550 ADSKQALRYYRY------VQAARDGQEQKDCNTEYPHCDIDYNIE 588
           AD++Q  +YY         +   DG    D ++EY  CD+ +NI+
Sbjct: 47  ADAEQCDKYYECNDGQITEKLCPDGMVFNDYSSEYEKCDLPFNID 91


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.134    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,203
Number of Sequences: 317
Number of extensions: 5196
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 588
length of database: 114,650
effective HSP length: 61
effective length of query: 527
effective length of database: 95,313
effective search space: 50229951
effective search space used: 50229951
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)