GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000054-TA|BGIBMGA000054-PA|IPR012464|Protein of unknown
function DUF1676
         (588 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ253050-1|CAB76503.1|   98|Homo sapiens immunoglobulin heavy ch...    31   8.6  

>AJ253050-1|CAB76503.1|   98|Homo sapiens immunoglobulin heavy chain
           protein.
          Length = 98

 Score = 31.5 bits (68), Expect = 8.6
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 315 FEHYPQDWELSGPGLGSEYLGSDIHRNAIASFKPHVNDANDINA 358
           F HY   W    PG G E++G +I+R+   ++ P +     I+A
Sbjct: 20  FSHYSWSWIRQPPGKGLEWIG-EINRSGATNYNPSLKSRVTISA 62


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.317    0.134    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,578,376
Number of Sequences: 224733
Number of extensions: 2994898
Number of successful extensions: 11189
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11189
Number of HSP's gapped (non-prelim): 1
length of query: 588
length of database: 73,234,838
effective HSP length: 94
effective length of query: 494
effective length of database: 52,109,936
effective search space: 25742308384
effective search space used: 25742308384
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 68 (31.5 bits)