BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000052-TA|BGIBMGA000052-PA|IPR012338|Penicillin-binding
protein, transpeptidase fold, IPR012464|Protein of unknown function
DUF1676
(222 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_22306| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4
>SB_22306| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 355
Score = 27.5 bits (58), Expect = 9.4
Identities = 11/31 (35%), Positives = 19/31 (61%)
Query: 49 NPEEKLNRFLLYRLQDYLDGHSLKYKLLDPQ 79
NP+ KL F L++ L+ + L+YK+ P+
Sbjct: 224 NPKNKLKTFRLFKSNYKLEDYLLEYKITKPR 254
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.316 0.136 0.393
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,474,209
Number of Sequences: 59808
Number of extensions: 105651
Number of successful extensions: 138
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 137
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 16,821,457
effective HSP length: 79
effective length of query: 143
effective length of database: 12,096,625
effective search space: 1729817375
effective search space used: 1729817375
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 58 (27.5 bits)
- SilkBase 1999-2023 -