BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000052-TA|BGIBMGA000052-PA|IPR012338|Penicillin-binding protein, transpeptidase fold, IPR012464|Protein of unknown function DUF1676 (222 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.5 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 9.5 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 55 NRFLLYRLQDYLDGHSLKY-KLLDPQTTKQAMDMAKGDPESIGRKS 99 NRF+ L L G K + T + AMD + +P +IG+ S Sbjct: 701 NRFIRPLLIKNLQGPEPKILETYSKLTMRDAMDYMRRNPSTIGQMS 746 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.136 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,003 Number of Sequences: 2123 Number of extensions: 3484 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 222 length of database: 516,269 effective HSP length: 62 effective length of query: 160 effective length of database: 384,643 effective search space: 61542880 effective search space used: 61542880 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -