GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000052-TA|BGIBMGA000052-PA|IPR012338|Penicillin-binding
protein, transpeptidase fold, IPR012464|Protein of unknown function
DUF1676
         (222 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p...    23   9.5  

>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal
           ion/proton exchanger 3 protein.
          Length = 1221

 Score = 22.6 bits (46), Expect = 9.5
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 55  NRFLLYRLQDYLDGHSLKY-KLLDPQTTKQAMDMAKGDPESIGRKS 99
           NRF+   L   L G   K  +     T + AMD  + +P +IG+ S
Sbjct: 701 NRFIRPLLIKNLQGPEPKILETYSKLTMRDAMDYMRRNPSTIGQMS 746


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.316    0.136    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,003
Number of Sequences: 2123
Number of extensions: 3484
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 516,269
effective HSP length: 62
effective length of query: 160
effective length of database: 384,643
effective search space: 61542880
effective search space used: 61542880
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)