BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000051-TA|BGIBMGA000051-PA|IPR012464|Protein of unknown function DUF1676 (248 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113409-1|AAI13410.1| 1416|Homo sapiens uveal autoantigen with ... 31 3.8 BC113407-1|AAI13408.1| 1416|Homo sapiens uveal autoantigen with ... 31 3.8 AK000990-1|BAA91457.1| 535|Homo sapiens protein ( Homo sapiens ... 31 3.8 AF322916-1|AAG49577.1| 1416|Homo sapiens uveal autoantigen protein. 31 3.8 AB046781-1|BAB13387.2| 1416|Homo sapiens KIAA1561 protein protein. 31 3.8 >BC113409-1|AAI13410.1| 1416|Homo sapiens uveal autoantigen with coiled-coil domains and ankyrin repeats protein. Length = 1416 Score = 31.1 bits (67), Expect = 3.8 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query: 57 KLNGKQELKLLPGVSIVKEDLKENETKPDFAAELARALPSKPDERIDKYLLYSLGNYLDS 116 K N ++ KL + +++DL++ + + E+ RAL K DE ++K L Y + Sbjct: 1024 KKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDE-LNKQLKDLSQKYTEV 1082 Query: 117 HTVRLRLLDDGAAEEARAL 135 V+ +L+++ A + + L Sbjct: 1083 KNVKEKLVEENAKQTSEIL 1101 >BC113407-1|AAI13408.1| 1416|Homo sapiens uveal autoantigen with coiled-coil domains and ankyrin repeats protein. Length = 1416 Score = 31.1 bits (67), Expect = 3.8 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query: 57 KLNGKQELKLLPGVSIVKEDLKENETKPDFAAELARALPSKPDERIDKYLLYSLGNYLDS 116 K N ++ KL + +++DL++ + + E+ RAL K DE ++K L Y + Sbjct: 1024 KKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDE-LNKQLKDLSQKYTEV 1082 Query: 117 HTVRLRLLDDGAAEEARAL 135 V+ +L+++ A + + L Sbjct: 1083 KNVKEKLVEENAKQTSEIL 1101 >AK000990-1|BAA91457.1| 535|Homo sapiens protein ( Homo sapiens cDNA FLJ10128 fis, clone HEMBA1002997, weakly similar to CENTROMERIC PROTEIN E. ). Length = 535 Score = 31.1 bits (67), Expect = 3.8 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query: 57 KLNGKQELKLLPGVSIVKEDLKENETKPDFAAELARALPSKPDERIDKYLLYSLGNYLDS 116 K N ++ KL + +++DL++ + + E+ RAL K DE ++K L Y + Sbjct: 372 KKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDE-LNKQLKDLSQKYTEV 430 Query: 117 HTVRLRLLDDGAAEEARAL 135 V+ +L+++ A + + L Sbjct: 431 KNVKEKLVEENAKQTSEIL 449 >AF322916-1|AAG49577.1| 1416|Homo sapiens uveal autoantigen protein. Length = 1416 Score = 31.1 bits (67), Expect = 3.8 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query: 57 KLNGKQELKLLPGVSIVKEDLKENETKPDFAAELARALPSKPDERIDKYLLYSLGNYLDS 116 K N ++ KL + +++DL++ + + E+ RAL K DE ++K L Y + Sbjct: 1024 KKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDE-LNKQLKDLSQKYTEV 1082 Query: 117 HTVRLRLLDDGAAEEARAL 135 V+ +L+++ A + + L Sbjct: 1083 KNVKEKLVEENAKQTSEIL 1101 >AB046781-1|BAB13387.2| 1416|Homo sapiens KIAA1561 protein protein. Length = 1416 Score = 31.1 bits (67), Expect = 3.8 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Query: 57 KLNGKQELKLLPGVSIVKEDLKENETKPDFAAELARALPSKPDERIDKYLLYSLGNYLDS 116 K N ++ KL + +++DL++ + + E+ RAL K DE ++K L Y + Sbjct: 1024 KKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDE-LNKQLKDLSQKYTEV 1082 Query: 117 HTVRLRLLDDGAAEEARAL 135 V+ +L+++ A + + L Sbjct: 1083 KNVKEKLVEENAKQTSEIL 1101 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.314 0.133 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,008,517 Number of Sequences: 224733 Number of extensions: 1115207 Number of successful extensions: 2297 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 2297 Number of HSP's gapped (non-prelim): 5 length of query: 248 length of database: 73,234,838 effective HSP length: 88 effective length of query: 160 effective length of database: 53,458,334 effective search space: 8553333440 effective search space used: 8553333440 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -