BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000050-TA|BGIBMGA000050-PA|IPR012464|Protein of unknown function DUF1676 (174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.45 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 9.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 9.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 9.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 9.8 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.6 bits (51), Expect = 0.45 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 22 EDEGKLELFSGVFVEK-DATGEDKLNVKFDPGELREA 57 ED+G + F E +AT E KL +F+P ++R A Sbjct: 383 EDKGMYQCFIRNDQESAEATAELKLGGRFEPPQIRHA 419 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Query: 27 LELFSGVFVEKDATGEDKLNVKFDPGELREAARTFQEARGKIKK 70 L L+S + + + G ++ VK EL E + +EA+ K K+ Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQ 1089 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Query: 27 LELFSGVFVEKDATGEDKLNVKFDPGELREAARTFQEARGKIKK 70 L L+S + + + G ++ VK EL E + +EA+ K K+ Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQ 1089 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Query: 27 LELFSGVFVEKDATGEDKLNVKFDPGELREAARTFQEARGKIKK 70 L L+S + + + G ++ VK EL E + +EA+ K K+ Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQ 1089 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Query: 27 LELFSGVFVEKDATGEDKLNVKFDPGELREAARTFQEARGKIKK 70 L L+S + + + G ++ VK EL E + +EA+ K K+ Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQ 1089 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.136 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,939 Number of Sequences: 317 Number of extensions: 547 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 174 length of database: 114,650 effective HSP length: 53 effective length of query: 121 effective length of database: 97,849 effective search space: 11839729 effective search space used: 11839729 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -