SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000050-TA|BGIBMGA000050-PA|IPR012464|Protein of unknown
function DUF1676
         (174 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146748-1|AAO12063.1|  279|Anopheles gambiae odorant-binding pr...    23   6.9  

>AY146748-1|AAO12063.1|  279|Anopheles gambiae odorant-binding
           protein AgamOBP41 protein.
          Length = 279

 Score = 22.6 bits (46), Expect = 6.9
 Identities = 8/32 (25%), Positives = 18/32 (56%)

Query: 29  LFSGVFVEKDATGEDKLNVKFDPGELREAART 60
           L +GV+ +++    D+LN ++  G   +  +T
Sbjct: 201 LQTGVYSDREGVSIDRLNAQYGEGHCEKEFKT 232


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.313    0.136    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,463
Number of Sequences: 2123
Number of extensions: 2437
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 174
length of database: 516,269
effective HSP length: 60
effective length of query: 114
effective length of database: 388,889
effective search space: 44333346
effective search space used: 44333346
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -