BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000050-TA|BGIBMGA000050-PA|IPR012464|Protein of unknown
function DUF1676
(174 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 6.9
>AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding
protein AgamOBP41 protein.
Length = 279
Score = 22.6 bits (46), Expect = 6.9
Identities = 8/32 (25%), Positives = 18/32 (56%)
Query: 29 LFSGVFVEKDATGEDKLNVKFDPGELREAART 60
L +GV+ +++ D+LN ++ G + +T
Sbjct: 201 LQTGVYSDREGVSIDRLNAQYGEGHCEKEFKT 232
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.313 0.136 0.384
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,463
Number of Sequences: 2123
Number of extensions: 2437
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 174
length of database: 516,269
effective HSP length: 60
effective length of query: 114
effective length of database: 388,889
effective search space: 44333346
effective search space used: 44333346
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -