BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000050-TA|BGIBMGA000050-PA|IPR012464|Protein of unknown function DUF1676 (174 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 6.9 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 22.6 bits (46), Expect = 6.9 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 29 LFSGVFVEKDATGEDKLNVKFDPGELREAART 60 L +GV+ +++ D+LN ++ G + +T Sbjct: 201 LQTGVYSDREGVSIDRLNAQYGEGHCEKEFKT 232 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.136 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,463 Number of Sequences: 2123 Number of extensions: 2437 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 174 length of database: 516,269 effective HSP length: 60 effective length of query: 114 effective length of database: 388,889 effective search space: 44333346 effective search space used: 44333346 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -