GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000049-TA|BGIBMGA000049-PA|IPR012464|Protein of unknown
function DUF1676
         (222 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   5.9  

>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
          factor protein.
          Length = 441

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%)

Query: 15 YSIVKTETIFEFAPKNQDDYANRFNVTDPYSWLFTQGKFAP 55
          + +VK  T     PK        F   DP+ W +  G++ P
Sbjct: 58 FPVVKV-TAAGLDPKAMYTVLLEFVQIDPHRWKYVNGEWVP 97


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.135    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,047
Number of Sequences: 317
Number of extensions: 1323
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 114,650
effective HSP length: 54
effective length of query: 168
effective length of database: 97,532
effective search space: 16385376
effective search space used: 16385376
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)