GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000049-TA|BGIBMGA000049-PA|IPR012464|Protein of unknown
function DUF1676
         (222 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g38520.1 68418.m04658 hydrolase, alpha/beta fold family prote...    28   5.8  

>At5g38520.1 68418.m04658 hydrolase, alpha/beta fold family protein
           low similarity to hydrolase [Terrabacter sp. DBF63]
           GI:14196240; contains Pfam profile PF00561: hydrolase,
           alpha/beta fold family
          Length = 362

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 134 LLIPIALKALAFVSAKGLMMGFFSTVMASVLSLKGMFENSHAYQNRKDDTKTQVEIIQVP 193
           LL+P+ L     +  +G+    F+ V     +LK +  N +  ++  DDT   VEII  P
Sbjct: 208 LLMPLLLLIDFLLKQRGIASALFNRVKDRE-NLKNILTNVYGNKDNVDDTL--VEIIAGP 264

Query: 194 TKTE 197
             TE
Sbjct: 265 ANTE 268


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.319    0.135    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,058,681
Number of Sequences: 28952
Number of extensions: 137244
Number of successful extensions: 287
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 287
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 12,070,560
effective HSP length: 78
effective length of query: 144
effective length of database: 9,812,304
effective search space: 1412971776
effective search space used: 1412971776
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 58 (27.5 bits)