BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000048-TA|BGIBMGA000048-PA|undefined
(272 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 28 1.6
>SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces
pombe|chr 1|||Manual
Length = 728
Score = 27.9 bits (59), Expect = 1.6
Identities = 10/30 (33%), Positives = 19/30 (63%)
Query: 1 MEFKLQWQFVLCFIVMSTADNDYENRLTKL 30
++F+L F+L FI + N+YE++ T +
Sbjct: 3 LQFRLYLLFILLFISFANGKNEYEDKSTSI 32
Database: spombe
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.317 0.133 0.391
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 829,198
Number of Sequences: 5004
Number of extensions: 26986
Number of successful extensions: 76
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 75
Number of HSP's gapped (non-prelim): 1
length of query: 272
length of database: 2,362,478
effective HSP length: 72
effective length of query: 200
effective length of database: 2,002,190
effective search space: 400438000
effective search space used: 400438000
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 53 (25.4 bits)
- SilkBase 1999-2023 -