BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000048-TA|BGIBMGA000048-PA|undefined (272 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 28 1.6 >SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 728 Score = 27.9 bits (59), Expect = 1.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MEFKLQWQFVLCFIVMSTADNDYENRLTKL 30 ++F+L F+L FI + N+YE++ T + Sbjct: 3 LQFRLYLLFILLFISFANGKNEYEDKSTSI 32 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.133 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 829,198 Number of Sequences: 5004 Number of extensions: 26986 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 1 length of query: 272 length of database: 2,362,478 effective HSP length: 72 effective length of query: 200 effective length of database: 2,002,190 effective search space: 400438000 effective search space used: 400438000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -