GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000048-TA|BGIBMGA000048-PA|undefined
         (272 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein ...    25   2.3  

>AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein
           protein.
          Length = 680

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 14/36 (38%), Positives = 17/36 (47%)

Query: 48  TSASIVIQPSSYSRPKTQNRKYAFRPRAIPLKKEEP 83
           TS   V  P S SR +T  R      RA+   K+EP
Sbjct: 560 TSPPAVATPPSTSRARTATRTATTTTRALRSAKKEP 595


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.133    0.391 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,544
Number of Sequences: 2123
Number of extensions: 5030
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 272
length of database: 516,269
effective HSP length: 63
effective length of query: 209
effective length of database: 382,520
effective search space: 79946680
effective search space used: 79946680
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)