BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000047-TA|BGIBMGA000047-PA|IPR012464|Protein of unknown function DUF1676 (178 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 1.4 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 2.5 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/41 (29%), Positives = 21/41 (51%) Query: 94 DKNEALTQMLWDKVASFANSRTIQLALPKMTGAELNRGVEE 134 D NEA+ + + K+ S +SR + +LNR V++ Sbjct: 260 DFNEAIKEAYFPKLDSLVSSRAWPSRVANQKLRDLNREVDQ 300 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 2.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 65 VDIVKVSKTDENVPISENEIDAAL 88 V++ ++ K D+N I N +DA L Sbjct: 553 VNVSEILKMDQNGQIKRNLVDAPL 576 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,571 Number of Sequences: 317 Number of extensions: 1011 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 178 length of database: 114,650 effective HSP length: 53 effective length of query: 125 effective length of database: 97,849 effective search space: 12231125 effective search space used: 12231125 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -