BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000046-TA|BGIBMGA000046-PA|IPR012464|Protein of unknown function DUF1676 (314 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 25 0.54 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 6.7 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 25.4 bits (53), Expect = 0.54 Identities = 14/36 (38%), Positives = 17/36 (47%) Query: 61 RLNEYEDSDTFSLATGVALVRDEKTPRDIGTFLDKD 96 RLN + T +LA GV R E P T D+D Sbjct: 30 RLNSIKKLSTIALALGVERTRSELIPFLTETIYDED 65 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 3 LRLVLLLCFVAGVIPIQLSLQEGEEIN 29 L+ VLLL + GV P+ +E E+++ Sbjct: 28 LKKVLLLSQIVGVFPLNHLNEEPEKLH 54 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,239 Number of Sequences: 317 Number of extensions: 2261 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 314 length of database: 114,650 effective HSP length: 57 effective length of query: 257 effective length of database: 96,581 effective search space: 24821317 effective search space used: 24821317 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -