SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000046-TA|BGIBMGA000046-PA|IPR012464|Protein of unknown
function DUF1676
         (314 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy...    28   2.0  

>SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1201

 Score = 27.9 bits (59), Expect = 2.0
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 82  DEKTPRDIGTFLDKDPMDFRSI--MEDASNLISKRSLHWDLSAMYPGLVMRIGPTLANGV 139
           DEKT R    F +++ +DF SI  +ED    + +  +   L  +YP + + +  T   GV
Sbjct: 353 DEKTIRSTDPFANRENLDFNSIGGLEDIILQLKEMVM---LPLLYPEVFLHLHITPPRGV 409

Query: 140 L 140
           L
Sbjct: 410 L 410


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.319    0.136    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,217,499
Number of Sequences: 5004
Number of extensions: 45053
Number of successful extensions: 103
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 103
Number of HSP's gapped (non-prelim): 1
length of query: 314
length of database: 2,362,478
effective HSP length: 73
effective length of query: 241
effective length of database: 1,997,186
effective search space: 481321826
effective search space used: 481321826
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)

- SilkBase 1999-2023 -