BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000046-TA|BGIBMGA000046-PA|IPR012464|Protein of unknown
function DUF1676
(314 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy... 28 2.0
>SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces
pombe|chr 2|||Manual
Length = 1201
Score = 27.9 bits (59), Expect = 2.0
Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)
Query: 82 DEKTPRDIGTFLDKDPMDFRSI--MEDASNLISKRSLHWDLSAMYPGLVMRIGPTLANGV 139
DEKT R F +++ +DF SI +ED + + + L +YP + + + T GV
Sbjct: 353 DEKTIRSTDPFANRENLDFNSIGGLEDIILQLKEMVM---LPLLYPEVFLHLHITPPRGV 409
Query: 140 L 140
L
Sbjct: 410 L 410
Database: spombe
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.319 0.136 0.397
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,217,499
Number of Sequences: 5004
Number of extensions: 45053
Number of successful extensions: 103
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 103
Number of HSP's gapped (non-prelim): 1
length of query: 314
length of database: 2,362,478
effective HSP length: 73
effective length of query: 241
effective length of database: 1,997,186
effective search space: 481321826
effective search space used: 481321826
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)
- SilkBase 1999-2023 -