BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000046-TA|BGIBMGA000046-PA|IPR012464|Protein of unknown function DUF1676 (314 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy... 28 2.0 >SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1201 Score = 27.9 bits (59), Expect = 2.0 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Query: 82 DEKTPRDIGTFLDKDPMDFRSI--MEDASNLISKRSLHWDLSAMYPGLVMRIGPTLANGV 139 DEKT R F +++ +DF SI +ED + + + L +YP + + + T GV Sbjct: 353 DEKTIRSTDPFANRENLDFNSIGGLEDIILQLKEMVM---LPLLYPEVFLHLHITPPRGV 409 Query: 140 L 140 L Sbjct: 410 L 410 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.136 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,217,499 Number of Sequences: 5004 Number of extensions: 45053 Number of successful extensions: 103 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 103 Number of HSP's gapped (non-prelim): 1 length of query: 314 length of database: 2,362,478 effective HSP length: 73 effective length of query: 241 effective length of database: 1,997,186 effective search space: 481321826 effective search space used: 481321826 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -