BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000045-TA|BGIBMGA000045-PA|IPR012464|Protein of unknown function DUF1676 (241 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420... 29 3.4 07_01_0353 + 2563807-2564496,2564595-2564660,2564853-2564918,256... 28 7.8 >04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052, 33742154-33742560,33743342-33743476,33743576-33743970, 33744225-33744916,33745014-33745097,33745195-33745286, 33745374-33745457,33745535-33745714,33746258-33746302, 33746399-33746692,33747199-33747585,33747713-33747899, 33748042-33748118,33748936-33749067,33749315-33749416, 33749744-33749827,33749902-33749992,33750105-33750178, 33750644-33750664,33751433-33751477,33752427-33752561, 33752693-33752752 Length = 1376 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/46 (21%), Positives = 23/46 (50%) Query: 17 RDSTLETAISFVQDCNEDYFLCVKEKLLRIVENARTSRSVNLVDGV 62 + ++ + F QDC E YF+ + + L+I+ + + +G+ Sbjct: 1237 KKDAIQKLVKFFQDCPEQYFVHILDAFLKIITKSSRINTAMATNGL 1282 >07_01_0353 + 2563807-2564496,2564595-2564660,2564853-2564918, 2565044-2565115,2565196-2565261,2565355-2565417, 2565505-2565570,2565963-2566062,2567403-2567504, 2567772-2567995,2568200-2568314,2568653-2568763, 2568873-2569088,2569426-2569624,2570690-2570790, 2570872-2570919,2571052-2571236,2571345-2571462, 2571572-2571699,2571981-2572107,2572529-2572647, 2572770-2572938,2573078-2573162,2573247-2573320, 2573449-2573568,2574068-2574251,2574343-2574464, 2574548-2574755,2574885-2574958,2575047-2575185, 2575275-2575456,2575852-2576007,2576153-2576284, 2576508-2576566,2576913-2576945,2577065-2577196, 2577303-2577479 Length = 1675 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 64 IKGEPGKPSTEPLPADPEARDAEVNYRLLDGVV 96 ++G+P STEP+ +PE EV +L DG V Sbjct: 1528 VEGQPISASTEPIAVEPEIY-KEVKQKLDDGSV 1559 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.132 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,939,067 Number of Sequences: 37544 Number of extensions: 165483 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 360 Number of HSP's gapped (non-prelim): 2 length of query: 241 length of database: 14,793,348 effective HSP length: 80 effective length of query: 161 effective length of database: 11,789,828 effective search space: 1898162308 effective search space used: 1898162308 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -