BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000044-TA|BGIBMGA000044-PA|IPR012464|Protein of unknown function DUF1676 (261 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 0.44 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 2.3 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 25.4 bits (53), Expect = 0.44 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 63 DGVKIYKSADVIQTGAPRSLDPLSRLKSYLETHSLSV 99 +GV+I + DVI+T P PL RL + + L V Sbjct: 193 EGVEI-RIPDVIKTSGPHKFQPLLRLPKFKKKPLLCV 228 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 6 FIFALIAATSALPAQDTSYSENDLDDCLKKD 36 F+ A+ ++ + T Y DLD+ +K D Sbjct: 10 FVIAIASSLAENSKYTTKYDNVDLDEIIKSD 40 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.129 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,334 Number of Sequences: 317 Number of extensions: 1255 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 261 length of database: 114,650 effective HSP length: 56 effective length of query: 205 effective length of database: 96,898 effective search space: 19864090 effective search space used: 19864090 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -