BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000043-TA|BGIBMGA000043-PA|undefined (163 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 5.1 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 20 9.0 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/21 (28%), Positives = 16/21 (76%) Query: 70 LIEKDRVAQIFAQSLKVVDET 90 ++E + +++ F Q+L ++DE+ Sbjct: 502 MLETNNLSETFTQNLSLMDES 522 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.2 bits (40), Expect = 9.0 Identities = 11/38 (28%), Positives = 18/38 (47%) Query: 55 AKFLQGHELHIKLPKLIEKDRVAQIFAQSLKVVDETYK 92 +K +E+HIK+ + K+ F + VV YK Sbjct: 53 SKSFHRNEIHIKIVLMFFKEASLYCFNYYVIVVTTFYK 90 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.140 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,799 Number of Sequences: 317 Number of extensions: 1270 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 163 length of database: 114,650 effective HSP length: 52 effective length of query: 111 effective length of database: 98,166 effective search space: 10896426 effective search space used: 10896426 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -