BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000043-TA|BGIBMGA000043-PA|undefined (163 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0308 - 22199389-22199451,22199604-22199924,22200178-222004... 29 1.4 05_04_0154 - 18549806-18550161,18550271-18550907 29 2.4 05_03_0442 + 14040280-14040371,14040449-14040517,14041217-140413... 28 4.2 03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883,971... 27 5.6 09_04_0197 - 15522167-15523524,15525416-15525683 27 7.4 08_02_0733 + 20546072-20546325,20546924-20547017,20547441-205476... 27 7.4 02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569... 27 7.4 09_04_0315 + 16600387-16600557,16600652-16600801,16600874-166008... 27 9.7 08_02_0520 - 18121561-18121821,18122216-18122470,18122560-181227... 27 9.7 >09_06_0308 - 22199389-22199451,22199604-22199924,22200178-22200423, 22202152-22203337,22203487-22203551,22204205-22204486, 22205005-22205106,22205587-22206105 Length = 927 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Query: 67 LPKLIEKDRVAQIFAQSLKVVDETYKENGVTGRGKGDG 104 LP ++ R+ Q+F++ KVVD + TGR +G G Sbjct: 244 LPWQVDDSRLVQLFSEHGKVVDARVVYDRETGRSRGFG 281 >05_04_0154 - 18549806-18550161,18550271-18550907 Length = 330 Score = 28.7 bits (61), Expect = 2.4 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 7/73 (9%) Query: 44 RSFDNSVLYRMAKFLQGHELHIKLPKLIEKDRVAQI------FAQSLKVVDETYKENG-V 96 RSFD S +++A F H++ P + RV + FA V + G + Sbjct: 203 RSFDTSSSHQVASFRDALPRHVRAPAVFRCVRVTSVDDGDDEFAYQAAVTINGHMFRGFL 262 Query: 97 TGRGKGDGSGGVA 109 +G DG GG+A Sbjct: 263 YDQGADDGRGGMA 275 >05_03_0442 + 14040280-14040371,14040449-14040517,14041217-14041329, 14043110-14043209,14044508-14044682,14044768-14044881, 14045157-14045287,14048401-14048464,14048585-14048624, 14049002-14049225,14049634-14049876,14050145-14050313, 14050569-14050873,14051325-14051511,14051622-14051775, 14052145-14052207,14052300-14052396,14052500-14052589 Length = 809 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Query: 85 KVVDETYKENGVTGRGKGDGSGGVALLGM 113 +V+++T+ + +TG G G GS G+ LGM Sbjct: 473 RVIEKTFNDMSITGSGFGSGS-GLGGLGM 500 >03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883, 9715973-9716146,9716260-9716373,9716975-9717033, 9717170-9717236,9717305-9717356,9718070-9718488, 9718786-9718847,9719305-9719374,9719730-9719831, 9719933-9720063,9720492-9720606,9720792-9720827 Length = 806 Score = 27.5 bits (58), Expect = 5.6 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 7/74 (9%) Query: 12 TSALGSFLDKDIDLADGVKLVSIPVPKTLENGRSFD------NSVLYRMAKFLQGHELHI 65 +SAL + L++ IDL D V + + + K LE RS + + L M K H L Sbjct: 619 SSALDNELEEGIDLQDQVTWLKVELCKLLEEKRSAELRSEELETALMEMVKQDNRHMLSA 678 Query: 66 K-LPKLIEKDRVAQ 78 K L ++ ++ +VA+ Sbjct: 679 KVLIRMEQEQKVAE 692 >09_04_0197 - 15522167-15523524,15525416-15525683 Length = 541 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 31 LVSIPVPKTLENGRSFDNSVLYRMAKFLQGH 61 + S+ VPK ENG F N++L + L G+ Sbjct: 352 MTSLKVPKETENGLKFLNAILQYKFRGLSGY 382 >08_02_0733 + 20546072-20546325,20546924-20547017,20547441-20547624, 20547722-20547831,20548328-20548423,20548525-20548679, 20548743-20548986,20549159-20549314,20549600-20549829, 20552213-20552316,20552420-20552505,20552776-20553066, 20553383-20553475,20553640-20553735,20553838-20553939, 20554196-20554266,20554784-20555035,20555786-20556529, 20557038-20557119,20557192-20557347,20557446-20557655, 20558282-20558665 Length = 1397 Score = 27.1 bits (57), Expect = 7.4 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 66 KLPKLIEKDRVAQIFAQSLKVVDETYKENGVTGRGKGDGS 105 KL KL+E + + ++++KV E Y + G+T G+ DGS Sbjct: 567 KLAKLVEMESALEDKSKNVKVHAEGYDDAGMTRFGR-DGS 605 >02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390, 5698015-5698057 Length = 608 Score = 27.1 bits (57), Expect = 7.4 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 9 VFLTSALGS-FLDKDIDLADGVKLVSIPVPKTLENGR 44 VF++S +G+ L + I +A G+K+VSI KT+ R Sbjct: 433 VFVSSRIGADLLSEAITVATGLKVVSIHGDKTMNERR 469 >09_04_0315 + 16600387-16600557,16600652-16600801,16600874-16600897, 16601519-16602694,16603120-16603266,16603477-16603752 Length = 647 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 9 VFLTSALGSFLDKDIDLADGVKLVS 33 V L ALG+FLDK I GV++V+ Sbjct: 94 VGLCQALGAFLDKKIKFVIGVEVVT 118 >08_02_0520 - 18121561-18121821,18122216-18122470,18122560-18122731, 18122824-18123105,18123159-18123292,18123425-18123508, 18123611-18123901,18123982-18124314,18124620-18124750, 18124826-18124930,18125011-18125167,18125248-18125351, 18125442-18125602,18125800-18126116,18126369-18126650, 18127011-18127312,18127609-18127699,18127771-18127824, 18128110-18128186,18128279-18128438,18128545-18128629, 18129059-18129367,18129514-18129890 Length = 1507 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 38 KTLENGRSFDNSVLYRMAKFLQGHELHIKLPKLIEKDRVA 77 K NG D V R A ++ H+LHI P++ ++ +A Sbjct: 261 KVTYNGYGMDEFVAQRSAAYISQHDLHI--PEMTVRETLA 298 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.140 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,983,617 Number of Sequences: 37544 Number of extensions: 189053 Number of successful extensions: 727 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 722 Number of HSP's gapped (non-prelim): 10 length of query: 163 length of database: 14,793,348 effective HSP length: 77 effective length of query: 86 effective length of database: 11,902,460 effective search space: 1023611560 effective search space used: 1023611560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -