BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000042-TA|BGIBMGA000042-PA|IPR012464|Protein of unknown function DUF1676 (212 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21322-3|AAA62541.1| 1425|Caenorhabditis elegans Hypothetical pr... 29 3.3 U39995-6|AAF99997.1| 452|Caenorhabditis elegans Hypothetical pr... 27 7.6 >U21322-3|AAA62541.1| 1425|Caenorhabditis elegans Hypothetical protein K10D2.3 protein. Length = 1425 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Query: 11 ISGTPSIRPSEETIKRGLSAKCAAR-DTSSCIVHELVGYVDRMLKTAAVQISDDVLIVDE 69 + G S+ + +K GL+ K AA D S + + +++R K + +S+D +DE Sbjct: 748 VYGRNSLLRFKRVLKPGLNGKMAASMDGLSFVTKKGKKFINRWKKANVIILSEDSSEIDE 807 Query: 70 SNGAAAS 76 AA S Sbjct: 808 KTKAADS 814 >U39995-6|AAF99997.1| 452|Caenorhabditis elegans Hypothetical protein M60.7 protein. Length = 452 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 92 EDQAQQLIMDKLWNFATTRSLRYRLLNNADL 122 + Q Q+ + DK+ N+A +RY LL A + Sbjct: 11 QSQLQRALADKITNYAPIEEIRYILLRGAQV 41 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,466,415 Number of Sequences: 27539 Number of extensions: 161132 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 379 Number of HSP's gapped (non-prelim): 2 length of query: 212 length of database: 12,573,161 effective HSP length: 78 effective length of query: 134 effective length of database: 10,425,119 effective search space: 1396965946 effective search space used: 1396965946 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -