BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000040-TA|BGIBMGA000040-PA|undefined (142 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 2.2 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 20 8.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 2.2 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Query: 113 DFLNV--KGLKVEIPEGARTVEEET 135 D LN KG K IPE AR +E T Sbjct: 1450 DMLNTRTKGSKPIIPEAARFIEVAT 1474 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 20.2 bits (40), Expect = 8.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 58 DNNNETIKTNLFSLVPLDVETINSLGVKKTVRD 90 +N E N S + +D+ ++GV K RD Sbjct: 171 ENGKEFDCHNYMSELTVDILLETAMGVSKPTRD 203 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,978 Number of Sequences: 429 Number of extensions: 1487 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 142 length of database: 140,377 effective HSP length: 52 effective length of query: 90 effective length of database: 118,069 effective search space: 10626210 effective search space used: 10626210 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -