BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000039-TA|BGIBMGA000039-PA|IPR000875|Cecropin, IPR003254|Insect immunity protein and cecropin (59 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032655-2|CAB60457.1| 561|Caenorhabditis elegans Hypothetical ... 25 4.8 Z48809-5|CAE17927.1| 205|Caenorhabditis elegans Hypothetical pr... 25 8.4 AC025723-2|AAK29943.1| 581|Caenorhabditis elegans Hypothetical ... 25 8.4 >AL032655-2|CAB60457.1| 561|Caenorhabditis elegans Hypothetical protein Y6B3B.4 protein. Length = 561 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 10 LFVVVFATASAKPWNFFKE 28 LF +F SAK W+FF E Sbjct: 340 LFFYIFEDFSAKKWSFFPE 358 >Z48809-5|CAE17927.1| 205|Caenorhabditis elegans Hypothetical protein T01E8.8 protein. Length = 205 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 4 TRIIFFLFVVVFATASAKPWNFFKEIERAVARTRDAVIS 42 ++ + L +++F+T+SAK N+ + E A+ VIS Sbjct: 13 SKSLLILAIILFSTSSAKEKNYVEIPEPALLNGTSYVIS 51 >AC025723-2|AAK29943.1| 581|Caenorhabditis elegans Hypothetical protein Y54F10AM.8 protein. Length = 581 Score = 24.6 bits (51), Expect = 8.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 5 RIIFFLFVVVFATASAKPW 23 +++FFLF ++FA KP+ Sbjct: 2 KLLFFLFGLIFAVEQEKPY 20 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.338 0.141 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,191 Number of Sequences: 27539 Number of extensions: 14953 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 89 Number of HSP's gapped (non-prelim): 3 length of query: 59 length of database: 12,573,161 effective HSP length: 40 effective length of query: 19 effective length of database: 11,471,601 effective search space: 217960419 effective search space used: 217960419 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -