GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000034-TA|BGIBMGA000034-PA|IPR005225|Small GTP-binding
protein domain, IPR006689|ARF/SAR superfamily,
IPR006688|ADP-ribosylation factor, IPR006687|GTP-binding protein SAR1,
IPR001806|Ras GTPase
         (197 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    23   1.9  

>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 69  IKSVLSNGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVVD 109
           I+ +L    KL +  IGGQ K R + +    N  +   V+D
Sbjct: 262 IQQILIRMNKLCIQTIGGQIKPRKHEQRLLRNVGVHTVVLD 302


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.136    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 52,206
Number of Sequences: 429
Number of extensions: 1691
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 197
length of database: 140,377
effective HSP length: 55
effective length of query: 142
effective length of database: 116,782
effective search space: 16583044
effective search space used: 16583044
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)