BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000033-TA|BGIBMGA000033-PA|IPR013069|BTB/POZ, IPR000210|BTB (287 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19330.1 68418.m02303 armadillo/beta-catenin repeat family pr... 72 4e-13 At5g13060.1 68418.m01497 armadillo/beta-catenin repeat family pr... 62 3e-10 At5g19330.2 68418.m02304 armadillo/beta-catenin repeat family pr... 52 4e-07 At3g06190.1 68416.m00711 speckle-type POZ protein-related simila... 49 3e-06 At2g39760.1 68415.m04882 speckle-type POZ protein-related contai... 43 3e-04 At1g21780.1 68414.m02726 BTB/POZ domain-containing protein Conta... 42 4e-04 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 42 5e-04 At4g37610.1 68417.m05321 TAZ zinc finger family protein / BTB/PO... 41 8e-04 At5g21010.1 68418.m02497 speckle-type POZ protein-related contai... 41 0.001 At5g58550.1 68418.m07333 tetratricopeptide repeat (TPR)-containi... 40 0.001 At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Inter... 40 0.001 At3g43700.1 68416.m04664 speckle-type POZ protein-related contai... 40 0.003 At1g55760.1 68414.m06384 BTB/POZ domain-containing protein Inter... 38 0.008 At1g04390.1 68414.m00429 expressed protein 33 0.17 At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 33 0.29 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 33 0.29 At5g67385.1 68418.m08497 phototropic-responsive protein, putativ... 32 0.39 At2g41370.1 68415.m05106 ankyrin repeat family protein / BTB/POZ... 32 0.51 At1g63210.1 68414.m07144 hypothetical protein contains Pfam prof... 31 0.67 At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containi... 31 0.89 At3g06190.2 68416.m00712 speckle-type POZ protein-related simila... 31 0.89 At3g03740.1 68416.m00379 speckle-type POZ protein-related contai... 31 0.89 At5g38830.1 68418.m04697 tRNA synthetase class I (C) family prot... 31 1.2 At4g39430.1 68417.m05580 expressed protein ; expression support... 31 1.2 At3g48360.1 68416.m05278 speckle-type POZ protein-related conta... 31 1.2 At3g44060.1 68416.m04720 F-box family protein contains F-box dom... 31 1.2 At5g13260.1 68418.m01523 expressed protein 30 2.1 At3g57130.1 68416.m06360 ankyrin repeat family protein / BTB/POZ... 30 2.1 At3g56300.1 68416.m06258 tRNA synthetase class I (C) family prot... 29 2.7 At4g32190.1 68417.m04581 centromeric protein-related low similar... 29 4.8 At4g22270.1 68417.m03221 expressed protein 29 4.8 At4g04090.1 68417.m00578 speckle-type POZ protein-related contai... 29 4.8 At3g08570.1 68416.m00994 phototropic-responsive protein, putativ... 29 4.8 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 29 4.8 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 28 8.3 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 28 8.3 At2g40290.2 68415.m04961 eukaryotic translation initiation facto... 28 8.3 At2g40290.1 68415.m04960 eukaryotic translation initiation facto... 28 8.3 At2g01450.1 68415.m00068 mitogen-activated protein kinase, putat... 28 8.3 At1g04010.1 68414.m00387 lecithin:cholesterol acyltransferase fa... 28 8.3 >At5g19330.1 68418.m02303 armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein contains armadillo/beta-catenin-like repeats, Pfam:PF00514 and a BTB/POZ domain, Pfam:PF00651 Length = 710 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/108 (30%), Positives = 61/108 (56%), Gaps = 1/108 (0%) Query: 114 DMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYA 173 + YV T +DVTF ++ AHR L+A D +AMF G +RE ++R I +P +K Sbjct: 532 EQYVNNATLSDVTFLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWEV 591 Query: 174 FHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEEL 221 F +++ ++YT + + + +LL A+++ + L L EY + +++ Sbjct: 592 FELMMRFIYTGSV-DITNEISKDLLRAADQYLLEGLKRLCEYTIAQDI 638 >At5g13060.1 68418.m01497 armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein contains armadillo/beta-catenin-like repeats, Pfam:PF00514 and a BTB/POZ domain, Pfam:PF00651 Length = 709 Score = 62.5 bits (145), Expect = 3e-10 Identities = 29/108 (26%), Positives = 61/108 (56%), Gaps = 1/108 (0%) Query: 114 DMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYA 173 + +V T +DVTF +D AH+ L+A D +AMF G ++E N++ + +P ++ Sbjct: 531 EKFVNNPTMSDVTFLIDGKQFYAHKIGLVASSDIFRAMFDGLYKERNAQNVEIPNIRWEV 590 Query: 174 FHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEEL 221 F +++ ++Y+ +I ++ +LL A+++ + L EY + +E+ Sbjct: 591 FELMMKFIYSGRI-NIAKHLAKDLLVAADQYLLEGLKRQCEYTIAQEI 637 >At5g19330.2 68418.m02304 armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein contains armadillo/beta-catenin-like repeats, Pfam:PF00514 and a BTB/POZ domain, Pfam:PF00651 Length = 636 Score = 52.0 bits (119), Expect = 4e-07 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 16/114 (14%) Query: 114 DMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYA 173 + YV T +DVTF ++D +AMF G +RE ++R I +P +K Sbjct: 499 EQYVNNATLSDVTFLVEDAF---------------RAMFDGGYREKDARDIEIPNIKWEV 543 Query: 174 FHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEELRHKDRV 227 F +++ ++YT + + + +LL A+++ + L L EY + + L D V Sbjct: 544 FELMMRFIYTGSV-DITNEISKDLLRAADQYLLEGLKRLCEYTIAQYLTKSDTV 596 >At3g06190.1 68416.m00711 speckle-type POZ protein-related similar to SPOP (novel nuclear speckle-type protein) (SP:O43791) [Homo sapiens]; contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain Length = 406 Score = 49.2 bits (112), Expect = 3e-06 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 11/114 (9%) Query: 117 VERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHI 176 +E ADVTF +D AH+ +L AR +A G R N+ I + V+ F + Sbjct: 196 LESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENTNCIIIEDVQAPIFKM 255 Query: 177 LLCYMYTDKIPSVES--------ARCL---ELLELANRFCMNRLVNLVEYKVIE 219 LL ++Y D++P ++ A L LL A+R+ + RL + E K+ E Sbjct: 256 LLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCE 309 >At2g39760.1 68415.m04882 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 408 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/66 (31%), Positives = 35/66 (53%) Query: 124 DVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYMYT 183 D+ F + D + AH+ IL AR +A F G +N I + ++ F +L ++YT Sbjct: 195 DIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYT 254 Query: 184 DKIPSV 189 D +P+V Sbjct: 255 DVLPNV 260 >At1g21780.1 68414.m02726 BTB/POZ domain-containing protein Contains similarity to gb|AJ000644 SPOP (speckle-type POZ protein) from Homo sapiens and contains a PF|00651 BTB/POZ domain. ESTs gb|T75841, gb|R89974, gb|R30221, gb|N96386, gb|T76457, gb|AI100013 and gb|T76456 come from this gene;supported by full-length Length = 326 Score = 42.3 bits (95), Expect = 4e-04 Identities = 40/175 (22%), Positives = 72/175 (41%), Gaps = 6/175 (3%) Query: 98 EAFLLQFHVSITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFR 157 +A + T + +E + DV DG AH+AIL A K+MF Sbjct: 136 DATMQSISTQTTLKCLSRMLEESILTDVIIHTADGTLSAHKAILSASSTVFKSMFHHDLM 195 Query: 158 ESNSRVISLPGVKIYAFHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKV 217 E S I + + + LL Y+Y + L LL AN++ + L E + Sbjct: 196 EKESSTIHIDDMSRESCMALLSYLYGNITQEEFWKHRLALLGAANKYDITDLKAACEESL 255 Query: 218 IEELRHKDRVRGHEDEVVEIALSLLEPAKVRQGIRLLSKVFERAVEREKRIGSYY 272 +E++ + + + + E L LE K+++G + F + + + I S++ Sbjct: 256 MEDINSSNVL----ERLQEAWLYQLE--KLKKGCLMYLFDFGKIYDVREEISSFF 304 >At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 958 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 2/88 (2%) Query: 124 DVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLP--GVKIYAFHILLCYM 181 D++F + D R + + P KAM G FRE I+ G+ + + Sbjct: 250 DMSFCIGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFS 309 Query: 182 YTDKIPSVESARCLELLELANRFCMNRL 209 T+++ + LELL+LANRFC + L Sbjct: 310 RTNRLDNFPPNVVLELLKLANRFCCDEL 337 >At4g37610.1 68417.m05321 TAZ zinc finger family protein / BTB/POZ domain-containing protein contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF02135 : TAZ zinc finger; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 368 Score = 41.1 bits (92), Expect = 8e-04 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 2/121 (1%) Query: 109 TRRFRDMYVERNTFADVTFALDD-GIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLP 167 TR D + ADV DD G+ AH ++ D ++ M + H R+S+ + IS+ Sbjct: 41 TRDSWDRMFDEAHGADVLIHTDDNGLIYAHSNVIGMASDVIRGMMKQHKRKSHRKSISIL 100 Query: 168 GVKIYAFHILLCYMYTDKIPSVESAR-CLELLELANRFCMNRLVNLVEYKVIEELRHKDR 226 GV +A + + ++Y+ + + LL L++ + + L + E + L +K+ Sbjct: 101 GVPHHALRVFIRFLYSSCYEKQDMEDFAIHLLVLSHVYVVPHLKRVCESEFESSLLNKEN 160 Query: 227 V 227 V Sbjct: 161 V 161 >At5g21010.1 68418.m02497 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 410 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 4/82 (4%) Query: 123 ADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYMY 182 +D+TF + LAH+ +L AR K+ F F E+N+ +++ ++ F LL +MY Sbjct: 198 SDITFNIAGEKFLAHKLVLAARSPFFKSKFFSEF-EANNTEVTINDLEPKVFKALLQFMY 256 Query: 183 TDKIP-SVE--SARCLELLELA 201 D +P VE +A E L+L+ Sbjct: 257 KDSLPEDVEPATAHTFERLKLS 278 >At5g58550.1 68418.m07333 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 925 Score = 40.3 bits (90), Expect = 0.001 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 2/134 (1%) Query: 123 ADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLP--GVKIYAFHILLCY 180 +D++F + R+ + A P +AM G F ES + I G+ I A L Y Sbjct: 207 SDISFCVGSEKAKCVRSRIAALSRPFEAMLYGSFVESTTSEIDFSENGISIEAMLALNIY 266 Query: 181 MYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEELRHKDRVRGHEDEVVEIALS 240 ++ ELL+LA++FC + L + E ++ + D+ + +E + Sbjct: 267 SRIKRVDLFRVETVFELLQLASKFCCDDLKSECEARLAASVTDLDKALTFVEYALEERTT 326 Query: 241 LLEPAKVRQGIRLL 254 LL A ++ +R L Sbjct: 327 LLLSACLQVFLREL 340 >At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56 protein (GI:17483747) [Mus musculus] Length = 243 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%) Query: 136 AHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYMYTDKIPSVESARCL 195 AH+++L++R KAM + ES S I + V A + Y+YT + E C Sbjct: 82 AHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEACLDEQMAC- 140 Query: 196 ELLELANRFCMNRLVNLVEYKVIEEL 221 +LL ++ ++ + L + E ++ +L Sbjct: 141 DLLVMSEKYQVKHLKSYCERFLVTKL 166 >At3g43700.1 68416.m04664 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 415 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 123 ADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYMY 182 +DVTF + AH+ +L AR ++MF E+NS V+ + ++ F LL +MY Sbjct: 205 SDVTFDVAGEKFQAHKLVLAARSQFFRSMFYNTLAENNSDVV-ISDLEPKVFKALLHFMY 263 Query: 183 TDKIP 187 D +P Sbjct: 264 KDSLP 268 >At1g55760.1 68414.m06384 BTB/POZ domain-containing protein Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56 protein (GI:17483747) [Mus musculus] Length = 329 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/104 (24%), Positives = 47/104 (45%) Query: 122 FADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYM 181 + D+T DG AHRA+L AR ++MF +E I++ + + A L Y+ Sbjct: 163 YTDITINASDGSIGAHRAVLAARSPVFRSMFLHDLKEKELSEINVLDMPLDACQAFLSYI 222 Query: 182 YTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEELRHKD 225 Y + L LL+ A ++ + L +++++ K+ Sbjct: 223 YGNIQNEDFLIHRLALLQAAEKYDIADLKEACHLSLLDDIDTKN 266 >At1g04390.1 68414.m00429 expressed protein Length = 849 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 136 AHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAFHILLCYMYTDKIPSVES 191 +HR IL + C+ ++A+F+ +ES+ +++P V L+ + Y+D++P S Sbjct: 683 SHRVILSSGCEYLRALFRSGMQESHLDRLNVP-VSWLGLTKLVSWFYSDELPKPPS 737 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 157 RESNSRVISLPGVKIYAFHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYK 216 R S+ VI L GV H LL Y+YT + +ES L +L+++F + LV E Sbjct: 240 RSSDGDVIQLRGVSYPILHALLQYIYTGRTQILES-ELAPLRDLSSKFEVMSLVRQCEES 298 Query: 217 V 217 + Sbjct: 299 I 299 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 157 RESNSRVISLPGVKIYAFHILLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYK 216 R S+ VI L GV H LL Y+YT + +ES L +L+++F + LV E Sbjct: 240 RSSDGDVIQLRGVSYPILHALLQYIYTGRTQILES-ELAPLRDLSSKFEVMSLVRQCEES 298 Query: 217 V 217 + Sbjct: 299 I 299 >At5g67385.1 68418.m08497 phototropic-responsive protein, putative similar to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 663 Score = 32.3 bits (70), Expect = 0.39 Identities = 25/111 (22%), Positives = 47/111 (42%), Gaps = 7/111 (6%) Query: 107 SITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISL 166 S +R + + +DVT + + H+ LM++C +K + ++S+S VI + Sbjct: 11 SAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVIKI 70 Query: 167 P----GVKIYAFHILLCY--MYTDKIPSVESARC-LELLELANRFCMNRLV 210 P G + + CY + ++ RC E LE+ + LV Sbjct: 71 PDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLV 121 >At2g41370.1 68415.m05106 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 491 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/48 (33%), Positives = 27/48 (56%) Query: 107 SITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQG 154 S++ F ++ + F+DVTF+++ + AHR IL AR + F G Sbjct: 10 SLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG 57 >At1g63210.1 68414.m07144 hypothetical protein contains Pfam profile: PF04283 protein of unknown function (DUF439) Length = 1197 Score = 31.5 bits (68), Expect = 0.67 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 9/69 (13%) Query: 225 DRVRGHEDEVVEIALSLL--EPAKVRQGIRLLSKVFERAVEREKRIGSYYIVTHEPT--- 279 D VRG ED+ +E+A+ + EPA +R +++ + R+ +E + +Y ++ E + Sbjct: 806 DTVRGDEDDAIEMAIEHVRDEPASLR---KIVLDEYLRSKNQENKKETYSLIMRELSCGF 862 Query: 280 -DWLFMFSE 287 DW +F E Sbjct: 863 QDWRSLFKE 871 >At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 888 Score = 31.1 bits (67), Expect = 0.89 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Query: 119 RNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPG--VKIYAFHI 176 R+ +V F + + R + + P AM G+F ES I + V A + Sbjct: 176 RSVSKNVVFKIGEEKIACQRRKIASLSAPFHAMLYGNFTESLLDEIDMSENHVSSSAMRV 235 Query: 177 LLCYMYTDKIPSVESARCLELLELANRFCMNRL 209 + + + V LE+L AN+FC RL Sbjct: 236 VRDFSVVGVLIGVSKNLLLEVLVFANKFCCERL 268 >At3g06190.2 68416.m00712 speckle-type POZ protein-related similar to SPOP (novel nuclear speckle-type protein) (SP:O43791) [Homo sapiens]; contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain Length = 295 Score = 31.1 bits (67), Expect = 0.89 Identities = 16/50 (32%), Positives = 24/50 (48%) Query: 117 VERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISL 166 +E ADVTF +D AH+ +L AR +A G R N+ + + Sbjct: 196 LESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENTNSLEV 245 >At3g03740.1 68416.m00379 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 465 Score = 31.1 bits (67), Expect = 0.89 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query: 115 MYVERNTFADVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVISLPGVKIYAF 174 M +E +D+TF + AHR +L AR ++ F E + R I + ++ F Sbjct: 208 MLLENEDGSDITFNVSGEKFRAHRLVLAARSPVFESEFLDVTGEED-RDIEVTDMEPKVF 266 Query: 175 HILLCYMYTDKI 186 LL Y+Y D + Sbjct: 267 KALLHYIYKDAL 278 >At5g38830.1 68418.m04697 tRNA synthetase class I (C) family protein similar to SP|Q06752 Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA ligase) (CysRS) {Bacillus subtilis}; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 511 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 184 DKIPSVESARCLELLELANRFCMNRLVNLVEYKVIEELRHKDRVRGHEDEVVEIALSLLE 243 DKI + + L+L+NRFC LV++ + + H+ RV H D ++++ ++E Sbjct: 78 DKIIDRANKNGEDPLDLSNRFCDEYLVDMGALQCLPP-THQPRVSEHMDNIIKMIEKIIE 136 >At4g39430.1 68417.m05580 expressed protein ; expression supported by MPSS Length = 405 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Query: 205 CMNRLV-----NLVEYKVIEELRHKDRVRGHEDEVVEIALSLLEPAKVRQG 250 C+N+LV + Y++ EE+R +R +ED V+E +SL+E K+ G Sbjct: 302 CLNQLVFGTVRRSLRYQIAEEMRKLGFLRPYEDNVLE-RISLIEHLKIECG 351 >At3g48360.1 68416.m05278 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 364 Score = 30.7 bits (66), Expect = 1.2 Identities = 34/162 (20%), Positives = 70/162 (43%), Gaps = 14/162 (8%) Query: 123 ADVTFALDDGIHLAHRAILMARCDP-----MKAMFQGHFRESNSRVISLPGVKIYAFHIL 177 +DV D + + ++A P MK + + + RVI + GV A + Sbjct: 34 SDVEIVTSDNRRIPAHSGVLASASPVLMNIMKKPMRRYRGCGSKRVIKILGVPCDAVSVF 93 Query: 178 LCYMYTDKIPSVESARC-LELLELANRFCMNRLVNLVEYKVIEELRHKDRVRGHEDEVVE 236 + ++Y+ + E R + LL L++ + + +L V++ L ++ V +V++ Sbjct: 94 IKFLYSSSLTEDEMERYGIHLLALSHVYMVTQLKQRCSKGVVQRLTTENVV-----DVLQ 148 Query: 237 IALSLLEPAKVRQGIRLLSKVFERAVEREKRIGSYYIVTHEP 278 +A P + +RL+ F+ + E G +I H+P Sbjct: 149 LARLCDAPDVCLRSMRLIHSQFKTVEQTE---GWKFIQEHDP 187 >At3g44060.1 68416.m04720 F-box family protein contains F-box domain Pfam:PF00646 Length = 427 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/69 (30%), Positives = 30/69 (43%) Query: 67 DNEIRQASELLGIPELTRTSQLILTQQMLYDEAFLLQFHVSITRRFRDMYVERNTFADVT 126 D+ + Q LL E TS L + L+ + L FH I+ R D+ N F D + Sbjct: 6 DDLLVQILYLLPTKEAVSTSVLSKRWRTLFTRSDNLDFHDPISGRPEDILKSFNDFVDSS 65 Query: 127 FALDDGIHL 135 A G H+ Sbjct: 66 LAFQGGKHI 74 >At5g13260.1 68418.m01523 expressed protein Length = 537 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 21 QLRNSRLEYHPESSPKHLRNDEHDNGHDNGRDNADPPESRYIQFNID 67 +LRN P ++PK + D GH NG+D+ D E+ ++ +D Sbjct: 152 KLRNQTTNPLPVATPKTEKRVLADIGHFNGKDSKDQHEASALRDELD 198 >At3g57130.1 68416.m06360 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 467 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/38 (34%), Positives = 24/38 (63%) Query: 107 SITRRFRDMYVERNTFADVTFALDDGIHLAHRAILMAR 144 S++ + ++ + F+DVTF+++ + AHR IL AR Sbjct: 11 SMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAAR 48 >At3g56300.1 68416.m06258 tRNA synthetase class I (C) family protein similar to cysteinyl-tRNA synthetase [Methanococcus maripaludis] GI:6599476; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 489 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/46 (26%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 198 LELANRFCMNRLVNLVEYKVIEELRHKDRVRGHEDEVVEIALSLLE 243 L+L+NRFC L+++ + + H+ RV H ++++++ ++E Sbjct: 91 LDLSNRFCEEYLLDMAALQCLLP-THQPRVSDHMEQIIKMIEKIIE 135 >At4g32190.1 68417.m04581 centromeric protein-related low similarity to SP|Q02224 Centromeric protein E (CENP-E protein) {Homo sapiens} Length = 783 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Query: 218 IEELRHKDRVRGHEDEVVEIALSLLEP--AKVRQGIRLLSKVFERAV 262 IEEL+HK R R E ++ +L+L E K+RQ I SK A+ Sbjct: 184 IEELKHKLRERDEERAALQSSLTLKEEELEKMRQEIANRSKEVSMAI 230 >At4g22270.1 68417.m03221 expressed protein Length = 437 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Query: 209 LVNLVEYKV---IEELRHKDRVRGHEDEVVEIALSLLEPAKVRQGIRLLSKVFERAV 262 ++ + YK+ ++ LR D R E+ ++ +L E K+R+ +R++S F R + Sbjct: 199 IIVCILYKITCHLQTLRLDDFARCFASEITDVRSALGEHQKIRRNLRIVSHRFRRFI 255 >At4g04090.1 68417.m00578 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 192 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 4/97 (4%) Query: 136 AHRAILMARCDPMKAMFQGHFRESNSRV--ISLPGVKIYAFHILLCYMYTDKIPSVESAR 193 AH+ IL AR + + MF+ +++S++ I+L +K + + Y+D E A+ Sbjct: 40 AHKRILSARSEVFEEMFESDKYKASSKLETITLSEMKHEVLEAFVDFTYSDGSMLSEKAK 99 Query: 194 --CLELLELANRFCMNRLVNLVEYKVIEELRHKDRVR 228 + L A + + RL L ++I L + +R Sbjct: 100 QHAMSLYSAAKDYEIPRLWCLCRKELIASLNMSNALR 136 >At3g08570.1 68416.m00994 phototropic-responsive protein, putative similar to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 612 Score = 28.7 bits (61), Expect = 4.8 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 10/100 (10%) Query: 124 DVTFALDDGIHLAHRAILMARCDPMKAMFQGHFRESNSRVI-----SLP-GVKIYAFHIL 177 D+T +D L H+ L+ARC ++ M +ES+S + P G K + + Sbjct: 32 DITIVVDGESFLLHKFPLVARCGKIRKMV-AEMKESSSNLSHTELRDFPGGSKTFELAMK 90 Query: 178 LCY--MYTDKIPSVESARCLE-LLELANRFCMNRLVNLVE 214 CY + I +V + RC LE+ F L+ E Sbjct: 91 FCYGINFEITISNVVAIRCAAGYLEMTEDFKEENLIARTE 130 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 5/102 (4%) Query: 171 IYAFHILLCYMYTDKIPS---VESARCLELLELANRFC-MNRLVNLVEYKVIEELRHKDR 226 +YAF ++L + T K+ +EL E NR + ++ ++ Sbjct: 907 VYAFGVILLELLTGKVSGDIVCSDPGVVELTEWVLLLVGQNRATECFDPSIVGSQGSRNP 966 Query: 227 VRGHEDEVVEIALSLLEPAKVRQGIRLLSKVFERAVEREKRI 268 G +V+++ALS + PA R ++L+S+ R V + I Sbjct: 967 F-GVLTDVLQVALSCISPAPERPDMKLVSQELSRIVLKRTAI 1007 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Query: 15 DIQVLYQLRNSRLEYHPESSPKHLRNDEHDNGHDNGRDNAD 55 D + +L + R P SP +DEHD D+ NAD Sbjct: 62 DADLESELDHERYLDLPSESPSPSDDDEHDMNEDSANTNAD 102 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Query: 15 DIQVLYQLRNSRLEYHPESSPKHLRNDEHDNGHDNGRDNAD 55 D + +L + R P SP +DEHD D+ NAD Sbjct: 62 DADLESELDHERYLDLPSESPSPSDDDEHDMNEDSANTNAD 102 >At2g40290.2 68415.m04961 eukaryotic translation initiation factor 2 subunit 1, putative / eIF-2A, putative / eIF-2-alpha, putative similar to Swiss-Prot:P05198 eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF- 2alpha) (EIF-2A) [Homo sapiens] Length = 241 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 177 LLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIE 219 L C MY K P V+ A +++ +A+ M V+L+EY IE Sbjct: 8 LECRMYEAKYPEVDMAVMIQVKNIAD---MGAYVSLLEYNNIE 47 >At2g40290.1 68415.m04960 eukaryotic translation initiation factor 2 subunit 1, putative / eIF-2A, putative / eIF-2-alpha, putative similar to Swiss-Prot:P05198 eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF- 2alpha) (EIF-2A) [Homo sapiens] Length = 344 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 177 LLCYMYTDKIPSVESARCLELLELANRFCMNRLVNLVEYKVIE 219 L C MY K P V+ A +++ +A+ M V+L+EY IE Sbjct: 8 LECRMYEAKYPEVDMAVMIQVKNIAD---MGAYVSLLEYNNIE 47 >At2g01450.1 68415.m00068 mitogen-activated protein kinase, putative / MAPK, putative (MPK17) mitogen-activated protein kinase (MAPK)(AtMPK17), PMID:12119167 Length = 486 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 27 LEYHPESSPKHLRNDEHDNGH---DNGRDNADPPESRYIQFNIDNE 69 LEYHP+ ++L+ +E+ N H +G D +R + N D E Sbjct: 348 LEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDEE 393 >At1g04010.1 68414.m00387 lecithin:cholesterol acyltransferase family protein / LACT family protein weak similarity to SP|P40345 Phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (PDAT) {Saccharomyces cerevisiae}; contains Pfam profile PF02450: Lecithin:cholesterol acyltransferase (phosphatidylcholine-sterol acyltransferase) Length = 629 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 9 WGGGIADIQVLYQLRNSRLEYHPE--SSPKHLR-NDEHDNGHDNGRDNADPPESRYIQFN 65 W G +I + Q+ +++ PE S H+ N +H++G D + P +YI F Sbjct: 493 WLGPKVNITMAPQILIGKIKQQPEHDGSDVHVELNVDHEHGSDIIANMTKAPRVKYITFY 552 Query: 66 IDNE 69 D+E Sbjct: 553 EDSE 556 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.324 0.139 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,670,329 Number of Sequences: 28952 Number of extensions: 273164 Number of successful extensions: 993 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 965 Number of HSP's gapped (non-prelim): 42 length of query: 287 length of database: 12,070,560 effective HSP length: 80 effective length of query: 207 effective length of database: 9,754,400 effective search space: 2019160800 effective search space used: 2019160800 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -