BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000032-TA|BGIBMGA000032- PA|IPR005135|Endonuclease/exonuclease/phosphatase, IPR000300|Inositol polyphosphate related phosphatase (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4E9.02 |cig1|SPCC645.01|cyclin Cig1|Schizosaccharomyces pomb... 29 2.0 SPAP8A3.13c |||Vid 24 family protein|Schizosaccharomyces pombe|c... 28 3.6 SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 27 8.2 >SPCC4E9.02 |cig1|SPCC645.01|cyclin Cig1|Schizosaccharomyces pombe|chr 3|||Manual Length = 415 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 7 SEFLQAVSRMDPKFIALHLQEVGGKAYEKSMQ 38 +++LQ V+ MD FI H+ + AY SMQ Sbjct: 317 AKYLQEVTLMDEIFIGAHISFIAATAYYLSMQ 348 >SPAP8A3.13c |||Vid 24 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 547 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Query: 565 RCLDPYTPESADSPNAEGSDVEGRSTEPN-RDRSVSPTQLKHRLDRLLTGR-EAELGSSD 622 R LD + E + PN +G+ + S PN VS +Q H R +EL D Sbjct: 3 RSLDNFQNEDSSHPNEQGAWADSGSGFPNPNSNDVSNSQRNHHRHMFPLARIRSELSEQD 62 Query: 623 ST 624 S+ Sbjct: 63 SS 64 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 27.1 bits (57), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 324 PHLFEFPVKFPPTYPFE 340 P E P+ FPPTY F+ Sbjct: 781 PFFSELPITFPPTYKFD 797 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,746,179 Number of Sequences: 5004 Number of extensions: 107281 Number of successful extensions: 237 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 234 Number of HSP's gapped (non-prelim): 4 length of query: 656 length of database: 2,362,478 effective HSP length: 77 effective length of query: 579 effective length of database: 1,977,170 effective search space: 1144781430 effective search space used: 1144781430 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -