BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000030-TA|BGIBMGA000030-PA|IPR008908|Sarcoglycan alphaepsilon, IPR006644|Dystroglycan-type cadherin-like (507 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 24 2.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 24 2.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 2.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 2.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 3.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 6.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 7.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 7.9 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 114 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 289 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 347 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 2.6 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSIARSYSPKSTPNLASNYN 380 Y + S R + S++P++ NN+S S + NN+ +Y+ + L N N Sbjct: 289 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNY-NNYNKHNYNKLYYNIN 347 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.8 bits (49), Expect = 3.4 Identities = 29/110 (26%), Positives = 37/110 (33%), Gaps = 13/110 (11%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNSI-------ARSYSPKSTP 373 YA K +A + TD S + DN + SL + N I R Y Sbjct: 551 YADTHAKLVQAAFEQNTTDQSMDIDVCDNQTYTSLQMAMKNPIEFTDLSNERKYEDVCVL 610 Query: 374 NLASNYNRPQPPPYAGALHHRKSTASTRGHTPELLHDPSRTVLEESLKLL 423 +N + P PP R T T P L P R S+ LL Sbjct: 611 KTDTNQSCPSPP----VTTKRDGTQETEERLPPL--PPKRIRKMPSMPLL 654 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 6.0 Identities = 11/42 (26%), Positives = 20/42 (47%) Query: 321 YAAVSQKSARAELGRRGTDSSEQPQLADNNSSKSLGASPNNS 362 Y + S R + S++P++ NN+S S + NN+ Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNN 97 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 40 WTYQEFDQQYRFHASLLGKPEL 61 W + E +QY H G+P+L Sbjct: 173 WQWNEERKQYYLHQFATGQPDL 194 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 234 LTLDWCRFELLKTYYKPRSTVQLEYM 259 LT + F L YYK STV +M Sbjct: 290 LTEAYTEFNLTIKYYKSGSTVPFNFM 315 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 40 WTYQEFDQQYRFHASLLGKPEL 61 WT+ E +Q+ FH +P+L Sbjct: 180 WTFHEGRKQFYFHQFYKQQPDL 201 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.132 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,926 Number of Sequences: 429 Number of extensions: 6073 Number of successful extensions: 40 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 15 length of query: 507 length of database: 140,377 effective HSP length: 61 effective length of query: 446 effective length of database: 114,208 effective search space: 50936768 effective search space used: 50936768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -