BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000029-TA|BGIBMGA000029-PA|IPR002415|High mobility group-like nuclear protein, IPR004038|Ribosomal protein L7Ae/L30e/S12e/Gadd45, IPR004037|Ribosomal protein L7AE (156 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 48 1e-07 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 5.9 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 5.9 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 5.9 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 48.4 bits (110), Expect = 1e-07 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Query: 57 SNHKNYIRNGLKIVQKQLRLGEKGMVFFAGDISPIEIMCHLPAVCEEKDVQYCYTPSRKD 116 S N +R G+ V K + + +V A D+ PIE++ +LPA+C + V YC + Sbjct: 136 SKRANQLRQGINSVVKMVEQKKAQLVIIAHDVDPIELVVYLPALCRKMGVPYCIIKGKAR 195 Query: 117 IGAAMGTMRGCIMVLVKEHED 137 +G + + C V + + E+ Sbjct: 196 LGTLV-YRKTCTCVALTQFEN 215 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 22.6 bits (46), Expect = 5.9 Identities = 8/35 (22%), Positives = 19/35 (54%) Query: 88 ISPIEIMCHLPAVCEEKDVQYCYTPSRKDIGAAMG 122 + + +C +P ++ ++ YT ++K +GA G Sbjct: 178 VDAVASLCGVPFYMDKWEIDAVYTGAQKVLGAPPG 212 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 22.6 bits (46), Expect = 5.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 13 DQADVSIKAEPQSHDEKVEHCSIIA 37 +Q D+ + P S +V+HC++IA Sbjct: 158 EQCDILQEMFPDSSFIEVKHCTLIA 182 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 5.9 Identities = 7/26 (26%), Positives = 13/26 (50%) Query: 101 CEEKDVQYCYTPSRKDIGAAMGTMRG 126 C ++ +CY P+ + G+ M G Sbjct: 522 CHQECKDFCYGPNEDNCGSCMNVKDG 547 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,764 Number of Sequences: 2123 Number of extensions: 4846 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 156 length of database: 516,269 effective HSP length: 59 effective length of query: 97 effective length of database: 391,012 effective search space: 37928164 effective search space used: 37928164 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -