BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000029-TA|BGIBMGA000029-PA|IPR002415|High mobility group-like nuclear protein, IPR004038|Ribosomal protein L7Ae/L30e/S12e/Gadd45, IPR004037|Ribosomal protein L7AE (156 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 0.81 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 2.5 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 0.81 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 62 YIRNGLKIVQKQLRLGEKGMVFFAGDISPIEIMCHLPAVCE 102 ++R G K + +LRL + F G P E +C LP CE Sbjct: 555 WVRVG-KYLSGELRLNMSAIQFKLGHPEPPESVCSLP--CE 592 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 122 GTMRGCIMVLVKEHEDYKDLYEEVKSE 148 GT + I+V KD+YE+ K+E Sbjct: 44 GTTKDLILVKKSTAHFVKDIYEKYKNE 70 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,739 Number of Sequences: 429 Number of extensions: 1574 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 156 length of database: 140,377 effective HSP length: 53 effective length of query: 103 effective length of database: 117,640 effective search space: 12116920 effective search space used: 12116920 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -