BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000028-TA|BGIBMGA000028-PA|undefined (475 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0238 + 2496974-2497618,2497738-2497980,2498202-2499211,249... 30 3.5 10_08_0107 + 14855606-14855914,14856068-14856142,14856920-14857021 29 8.1 08_02_1499 - 27558872-27559015,27559544-27559666,27560214-275603... 29 8.1 >10_01_0238 + 2496974-2497618,2497738-2497980,2498202-2499211, 2499329-2499370,2499465-2499492 Length = 655 Score = 30.3 bits (65), Expect = 3.5 Identities = 37/129 (28%), Positives = 54/129 (41%), Gaps = 16/129 (12%) Query: 292 PNSIQFNAKAPAKSLTAIINYLLKTY---MDFDADVTEYVVPAVEYAKQTLKLAEKAAQS 348 P IQ A A+S+ A +++KT M F AD + VE + T+ + E S Sbjct: 535 PCIIQAEAYDSARSM-ATAEHMVKTALWCMQFSADHRPSMQKVVEMLQGTIDIDEPPNPS 593 Query: 349 VATREDYAAVSDRLTDALNLEVIEPVLRVYRAYRHSAAAPHCQEHLMCLVNRPEGDRKG- 407 S L D+ + EPV+++ YRH+ P E L+ R D KG Sbjct: 594 ----------SSNLYDSASYSSCEPVMKMSFNYRHNLPYPSSDEGEFKLLRR-MSDAKGL 642 Query: 408 APGLKAGLT 416 G + LT Sbjct: 643 GAGARTELT 651 >10_08_0107 + 14855606-14855914,14856068-14856142,14856920-14857021 Length = 161 Score = 29.1 bits (62), Expect = 8.1 Identities = 9/32 (28%), Positives = 21/32 (65%) Query: 76 NEKEEKEKDSGNIGDILSGLGSLMGGQDGKID 107 N + E+++D +GD+L+ + +GG D +++ Sbjct: 86 NARAERDEDKTTLGDVLADAAAKLGGADKEVE 117 >08_02_1499 - 27558872-27559015,27559544-27559666,27560214-27560312, 27561257-27561307 Length = 138 Score = 29.1 bits (62), Expect = 8.1 Identities = 13/31 (41%), Positives = 21/31 (67%) Query: 339 LKLAEKAAQSVATREDYAAVSDRLTDALNLE 369 + + E +AQS+AT ED AA+ D+L + + E Sbjct: 104 ISVEESSAQSIATVEDAAALIDKLVEQKSAE 134 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,150,846 Number of Sequences: 37544 Number of extensions: 518009 Number of successful extensions: 1153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1151 Number of HSP's gapped (non-prelim): 3 length of query: 475 length of database: 14,793,348 effective HSP length: 85 effective length of query: 390 effective length of database: 11,602,108 effective search space: 4524822120 effective search space used: 4524822120 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -