BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000021-TA|BGIBMGA000021-PA|IPR003254|Insect immunity protein and cecropin, IPR000875|Cecropin (63 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 20 2.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 19 5.1 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 19.8 bits (39), Expect = 2.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 2 NFAKILSFVFALVLALSM 19 NF K L F+F + L++ Sbjct: 440 NFRKKLDFIFTFITLLTI 457 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 18.6 bits (36), Expect = 5.1 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 13 LVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGP 50 L + + S P P IF + + N D ++K P Sbjct: 149 LAVKTTSKSLVPTPVTHIFLQNLILKENTYDAVIKWSP 186 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.137 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,395 Number of Sequences: 317 Number of extensions: 270 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 63 length of database: 114,650 effective HSP length: 43 effective length of query: 20 effective length of database: 101,019 effective search space: 2020380 effective search space used: 2020380 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.7 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -