BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000020-TA|BGIBMGA000020-PA|IPR000875|Cecropin (63 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera... 45 3e-04 UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re... 40 0.007 UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Re... 32 1.9 >UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera|Rep: Cecropin-B precursor - Bombyx mori (Silk moth) Length = 63 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/46 (43%), Positives = 26/46 (56%) Query: 1 MNFVKILCVVXXXXXXXXXXXXXXEPKRKVFKIIEKIGRNVRGGVI 46 MNF KIL V EP+ K+FK IEK+GRN+R G++ Sbjct: 1 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIV 46 >UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep: Cecropin-A precursor - Hyalophora cecropia (Cecropia moth) Length = 64 Score = 40.3 bits (90), Expect = 0.007 Identities = 19/46 (41%), Positives = 25/46 (54%) Query: 1 MNFVKILCVVXXXXXXXXXXXXXXEPKRKVFKIIEKIGRNVRGGVI 46 MNF +I V EPK K+FK IEK+G+N+R G+I Sbjct: 1 MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGII 46 >UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Rep: Cecropin A - Plutella xylostella (Diamondback moth) Length = 66 Score = 32.3 bits (70), Expect = 1.9 Identities = 12/21 (57%), Positives = 17/21 (80%) Query: 26 PKRKVFKIIEKIGRNVRGGVI 46 P+ K FK +EK+GRN+R G+I Sbjct: 24 PRWKPFKKLEKVGRNIRNGII 44 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.332 0.149 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,581,708 Number of Sequences: 1657284 Number of extensions: 494983 Number of successful extensions: 605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 602 Number of HSP's gapped (non-prelim): 3 length of query: 63 length of database: 575,637,011 effective HSP length: 43 effective length of query: 20 effective length of database: 504,373,799 effective search space: 10087475980 effective search space used: 10087475980 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -