BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000019-TA|BGIBMGA000019-PA|undefined (148 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37730.1 68415.m04627 fringe-related protein similarity to pr... 26 9.1 At1g11720.1 68414.m01345 starch synthase, putative strong simila... 26 9.1 >At2g37730.1 68415.m04627 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 532 Score = 26.2 bits (55), Expect = 9.1 Identities = 13/54 (24%), Positives = 21/54 (38%) Query: 80 NPRVMHEKPLHLLKVTAWSAVHAGGIIVDFFFENAAGQTTTMDDFFVGFLKSRD 133 +P +H KP + T H ++ FFF + M F++ F D Sbjct: 5 DPFKLHHKPPSIFPATTVKPSHVLSLVAKFFFTICIFISVAMISFYIIFFGCSD 58 >At1g11720.1 68414.m01345 starch synthase, putative strong similarity to soluble-starch-synthase [Solanum tuberosum] GI:1911166 Length = 1025 Score = 26.2 bits (55), Expect = 9.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 82 RVMHEKPLHLLKVTAWSAVHAGGIIV 107 R+ H+K +HL+K W + G +V Sbjct: 837 RLTHQKGIHLIKHAIWRTLERNGQVV 862 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.323 0.138 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,583,013 Number of Sequences: 28952 Number of extensions: 139559 Number of successful extensions: 257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 253 Number of HSP's gapped (non-prelim): 4 length of query: 148 length of database: 12,070,560 effective HSP length: 75 effective length of query: 73 effective length of database: 9,899,160 effective search space: 722638680 effective search space used: 722638680 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -