SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000017-TA|BGIBMGA000017-PA|IPR000875|Cecropin,
IPR003254|Insect immunity protein and cecropin
         (61 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF018974-1|AAB82471.1|   63|Drosophila melanogaster cecropin A1 ...    27   3.1  

>AF018974-1|AAB82471.1|   63|Drosophila melanogaster cecropin A1
          protein.
          Length = 63

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 29 KDLEKMGQRVRDAVISAAPAVDTLAKAKALGQG 61
          K +E++GQ  RDA I         A   A G+G
Sbjct: 31 KKIERVGQHTRDATIQGLGIAQQAANVAATGRG 63


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.317    0.132    0.366 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,583,982
Number of Sequences: 52641
Number of extensions: 30116
Number of successful extensions: 136
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 135
Number of HSP's gapped (non-prelim): 1
length of query: 61
length of database: 24,830,863
effective HSP length: 42
effective length of query: 19
effective length of database: 22,619,941
effective search space: 429778879
effective search space used: 429778879
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -