BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000013-TA|BGIBMGA000013-PA|IPR012464|Protein of unknown function DUF1676 (239 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0504 - 19771191-19772134,19772210-19774892 29 4.4 05_01_0084 + 562119-562411,562854-562902,563151-563162,563194-56... 28 5.8 >12_02_0504 - 19771191-19772134,19772210-19774892 Length = 1208 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/32 (34%), Positives = 22/32 (68%) Query: 36 NVALCLKEKALRYVENVSNSRELNLIDGVSLI 67 N+A+ L +KA Y++ V+ R+ L+ G+S++ Sbjct: 15 NLAMPLVDKAFSYMDGVNQDRKEKLLQGLSVV 46 >05_01_0084 + 562119-562411,562854-562902,563151-563162,563194-563327, 563716-566278 Length = 1016 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Query: 16 NNDEDVFRSV-MGVLKTCSDDNVALCLKEKALRYVENVSNSRELNLIDGVSLIGQGSPRS 74 N+D ++ + + ++ CSDD+ ++ + R + + N ++D + ++ SP S Sbjct: 462 NHDYEITLDIGLSTVEVCSDDDNSIPRLQYNFRQISELENMANETIVDLLGVVTSVSP-S 520 Query: 75 ARSFEPLPDEPRARENQV 92 A + E R R Q+ Sbjct: 521 ATIMRKIGTETRKRSIQL 538 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.136 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,326,186 Number of Sequences: 37544 Number of extensions: 138511 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 269 Number of HSP's gapped (non-prelim): 2 length of query: 239 length of database: 14,793,348 effective HSP length: 80 effective length of query: 159 effective length of database: 11,789,828 effective search space: 1874582652 effective search space used: 1874582652 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -