GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000013-TA|BGIBMGA000013-PA|IPR012464|Protein of unknown
function DUF1676
         (239 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U93867-1|AAB63675.1|  533|Homo sapiens RNA polymerase III subuni...    30   8.2  

>U93867-1|AAB63675.1|  533|Homo sapiens RNA polymerase III subunit
           protein.
          Length = 533

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 52  VSNSRELNLIDGVSLIGQGSPRSARSFEPLPDEPRARENQV 92
           V N +++ L+  +SLIG+G  R + S E    EP+AR+  +
Sbjct: 181 VINEKDMYLVPKLSLIGKGKRRRS-SDEDAAGEPKARDQNI 220


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.317    0.136    0.381 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,239,000
Number of Sequences: 224733
Number of extensions: 639826
Number of successful extensions: 1275
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1275
Number of HSP's gapped (non-prelim): 1
length of query: 239
length of database: 73,234,838
effective HSP length: 88
effective length of query: 151
effective length of database: 53,458,334
effective search space: 8072208434
effective search space used: 8072208434
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 64 (29.9 bits)