BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000011-TA|BGIBMGA000011-PA|IPR012464|Protein of unknown function DUF1676 (235 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 24 1.2 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.8 bits (49), Expect = 1.2 Identities = 14/47 (29%), Positives = 21/47 (44%) Query: 43 LKEKAMKFTDNLAVSKDLTVVDGISFSRTGSPRSARSYEALADDPKT 89 L K+ T L++S + SF + SP S+ S +L P T Sbjct: 33 LSNKSNSITVPLSISTGQRLPANFSFGQVNSPPSSTSSGSLGQFPAT 79 Score = 21.4 bits (43), Expect = 6.3 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 57 SKDLTVVDGISFSRTGSPRSARSYEALADDPKTREQQVEERIMDNV 102 +KD + + R GS + S+E+L + KT E ++++DN+ Sbjct: 85 AKDPAIYSNL-LPRPGS--NDNSWESLIEVTKTSETSKLQQLVDNI 127 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.130 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,148 Number of Sequences: 317 Number of extensions: 1115 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 235 length of database: 114,650 effective HSP length: 55 effective length of query: 180 effective length of database: 97,215 effective search space: 17498700 effective search space used: 17498700 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -