BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000011-TA|BGIBMGA000011-PA|IPR012464|Protein of unknown function DUF1676 (235 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81523-2|CAB04248.1| 928|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z81523-1|CAB04241.1| 944|Caenorhabditis elegans Hypothetical pr... 28 5.1 >Z81523-2|CAB04248.1| 928|Caenorhabditis elegans Hypothetical protein F32H2.1b protein. Length = 928 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 85 DDPKTREQQVEERI-MDNVVDFLDSHV-LQLRMPKYFEEDNSV 125 DD R+QQ++E + N D V + L MP YF++DN++ Sbjct: 66 DDNLKRQQQLKEEYRLYNRADITKRKVPVHLYMPPYFKDDNNM 108 >Z81523-1|CAB04241.1| 944|Caenorhabditis elegans Hypothetical protein F32H2.1a protein. Length = 944 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 85 DDPKTREQQVEERI-MDNVVDFLDSHV-LQLRMPKYFEEDNSV 125 DD R+QQ++E + N D V + L MP YF++DN++ Sbjct: 66 DDNLKRQQQLKEEYRLYNRADITKRKVPVHLYMPPYFKDDNNM 108 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.314 0.130 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,014,760 Number of Sequences: 27539 Number of extensions: 130520 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 282 Number of HSP's gapped (non-prelim): 2 length of query: 235 length of database: 12,573,161 effective HSP length: 79 effective length of query: 156 effective length of database: 10,397,580 effective search space: 1622022480 effective search space used: 1622022480 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -