BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000010-TA|BGIBMGA000010-PA|IPR012464|Protein of unknown function DUF1676 (240 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 1.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.9 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 8.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 8.5 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 10 IGVAWAMPAAEQDSDPNILGSVLGVVKECVDGDVTL 45 + +AW P + + LGS+ VK+ V GD L Sbjct: 151 LDLAWEFPENKPKKIRSKLGSIWHSVKKTVAGDKVL 186 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 205 VAHPHHEEHYASSGHGWGRSID 226 ++HP H YA + G GRS D Sbjct: 593 LSHPFHLHGYAFNVVGIGRSPD 614 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 205 VAHPHHEEHYASSGHGWGRSID 226 ++HP H YA + G GRS D Sbjct: 593 LSHPFHLHGYAFNVIGIGRSPD 614 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 8.5 Identities = 5/11 (45%), Positives = 8/11 (72%) Query: 207 HPHHEEHYASS 217 HPH +HY ++ Sbjct: 23 HPHQHQHYGAA 33 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.0 bits (42), Expect = 8.5 Identities = 5/11 (45%), Positives = 8/11 (72%) Query: 207 HPHHEEHYASS 217 HPH +HY ++ Sbjct: 23 HPHQHQHYGAA 33 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,757 Number of Sequences: 317 Number of extensions: 1269 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 240 length of database: 114,650 effective HSP length: 55 effective length of query: 185 effective length of database: 97,215 effective search space: 17984775 effective search space used: 17984775 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -